Escherichia coli ompF with mutation conferring resistance to beta-lactam antibiotics

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003390
CARD Short NameEcol_ompF_BLA
DefinitionThe Escherichia coli ompF (oprF) is a nonspecific porin channel involved in the membrane translocation of small hydrophilic molecules, including and especially beta-lactam antibiotics. Mutations in ompF can decrease diffusion of antibiotics across the cellular membrane, thereby decreasing overall susceptibility through absence of porin function.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams
Drug Classpenicillin beta-lactam, cephalosporin, carbapenem, monobactam
Resistance Mechanismreduced permeability to antibiotic
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic cefepime [Antibiotic]
+ porin OmpF
Resistomes with Sequence VariantsEscherichia coliwgs
Publications

Simonet V, et al. 2000. Antimicrob Agents Chemother 44(2): 311-315. Substitutions in the eyelet region disrupt cefepime diffusion through the Escherichia coli OmpF channel. (PMID 10639355)

Resistomes

Prevalence of Escherichia coli ompF with mutation conferring resistance to beta-lactam antibiotics among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Escherichia coli0%0%0.01%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 650

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
G141Dsingle resistance variantPMID:10639355
G141Esingle resistance variantPMID:10639355
R154Asingle resistance variantPMID:10639355
R154Dsingle resistance variantPMID:10639355

>gb|AAC74015.1|-|Escherichia coli ompF with mutation conferring resistance to beta-lactam antibiotics [Escherichia coli str. K-12 substr. MG1655]
MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDM
TYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDY
GRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYL
GKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGL
KYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKS
KAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVY
QF



>gb|U00096.3|-|985894-986982|Escherichia coli ompF with mutation conferring resistance to beta-lactam antibiotics [Escherichia coli str. K-12 substr. MG1655]
ATGATGAAGCGCAATATTCTGGCAGTGATCGTCCCTGCTCTGTTAGTAGCAGGTACTGCAAACGCTGCAGAAATCTATAACAAAGATGGC
AACAAAGTAGATCTGTACGGTAAAGCTGTTGGTCTGCATTATTTTTCCAAGGGTAACGGTGAAAACAGTTACGGTGGCAATGGCGACATG
ACCTATGCCCGTCTTGGTTTTAAAGGGGAAACTCAAATCAATTCCGATCTGACCGGTTATGGTCAGTGGGAATATAACTTCCAGGGTAAC
AACTCTGAAGGCGCTGACGCTCAAACTGGTAACAAAACGCGTCTGGCATTCGCGGGTCTTAAATACGCTGACGTTGGTTCTTTCGATTAC
GGCCGTAACTACGGTGTGGTTTATGATGCACTGGGTTACACCGATATGCTGCCAGAATTTGGTGGTGATACTGCATACAGCGATGACTTC
TTCGTTGGTCGTGTTGGCGGCGTTGCTACCTATCGTAACTCCAACTTCTTTGGTCTGGTTGATGGCCTGAACTTCGCTGTTCAGTACCTG
GGTAAAAACGAGCGTGACACTGCACGCCGTTCTAACGGCGACGGTGTTGGCGGTTCTATCAGCTACGAATACGAAGGCTTTGGTATCGTT
GGTGCTTATGGTGCAGCTGACCGTACCAACCTGCAAGAAGCTCAACCTCTTGGCAACGGTAAAAAAGCTGAACAGTGGGCTACTGGTCTG
AAGTACGACGCGAACAACATCTACCTGGCAGCGAACTACGGTGAAACCCGTAACGCTACGCCGATCACTAATAAATTTACAAACACCAGC
GGCTTCGCCAACAAAACGCAAGACGTTCTGTTAGTTGCGCAATACCAGTTCGATTTCGGTCTGCGTCCGTCCATCGCTTACACCAAATCT
AAAGCGAAAGACGTAGAAGGTATCGGTGATGTTGATCTGGTGAACTACTTTGAAGTGGGCGCAACCTACTACTTCAACAAAAACATGTCC
ACCTATGTTGACTACATCATCAACCAGATCGATTCTGACAACAAACTGGGCGTAGGTTCAGACGACACCGTTGCTGTGGGTATCGTTTAC
CAGTTCTAA

Curator Acknowledgements
Curator Description Most Recent Edit