Sed-1

Accession ARO:3003561
CARD Short NameSed-1
DefinitionSed-1 is a chromosomal-encoded class A beta-lactamase identified in Citrobacter sedlakii.
AMR Gene FamilySed beta-lactamase
Drug Classpenam, cephalosporin
Resistance Mechanismantibiotic inactivation
Classification14 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ confers_resistance_to_antibiotic cefuroxime [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ confers_resistance_to_antibiotic piperacillin [Antibiotic]
+ confers_resistance_to_antibiotic cefalotin [Antibiotic]
+ confers_resistance_to_antibiotic ticarcillin [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin-clavulanic acid [Antibiotic+Adjuvant]
+ Sed beta-lactamase [AMR Gene Family]
Publications

Petrella S, et al. 2001. Antimicrob Agents Chemother 45(8): 2287-2298. Novel class A beta-lactamase Sed-1 from Citrobacter sedlakii: genetic diversity of beta-lactamases within the Citrobacter genus. (PMID 11451687)

Resistomes

Prevalence of Sed-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550


>gb|AAK63223.1|+|Sed-1 [Citrobacter sedlakii]
MLKERFRQTVFIAAAVMPFIFSSTSLHAQATSDVQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQ
SETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAI
PGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGAGDYGTTNDIAVIWPEDRAPLVLVTYF
TQPQQDAKWRKDVLAAAAKIVTEGK


>gb|AF321608.1|+|1-888|Sed-1 [Citrobacter sedlakii]
ATGCTTAAGGAACGGTTTCGCCAGACGGTATTTATCGCTGCCGCTGTTATGCCCTTCATTTTTAGTAGCACTTCACTGCATGCGCAGGCG
ACGTCAGACGTGCAGCAGGTTCAGAAAAAGCTGGCGGCGCTGGAAAAGCAATCTGGCGGACGCCTGGGCGTGGCGCTGATTAATACCGCG
GATAATTCGCAGGTGCTGTACCGCGCAGACGAGCGTTTTGCGATGTGCAGCACCAGTAAGGTCATGACCGCCGCCGCGGTATTAAAACAG
AGTGAAACCCATGACGGTATTTTGCAGCAAAAAATGACCATTAAAAAAGCCGATCTGACCAACTGGAATCCCGTAACAGAGAAATATGTG
GGTAATACGATGACATTAGCTGAGCTAAGCGCAGCGACGTTACAGTACAGCGATAATACCGCCATGAATAAACTGCTGGCGCATCTTGGC
GGCCCCGGCAACGTCACGGCGTTTGCACGTTCCATTGGCGACACGACGTTTCGTCTCGATCGCAAAGAGCCGGAATTAAACACCGCCATT
CCCGGCGATGAGCGCGACACAACATCGCCGCTGGCCATGGCCAAAAGTCTGCGTAAACTCACGCTGGGCGACGCGCTGGCAGGGCCCCAG
CGCGCGCAGCTTGTCGACTGGCTGAAAGGCAACACCACCGGAGGCCAGAGCATTCGTGCCGGCCTTCCTGCACACTGGGTGGTGGGCGAT
AAAACCGGGGCGGGTGATTACGGCACCACGAATGACATCGCAGTGATCTGGCCGGAAGACCGCGCCCCGCTGGTGCTGGTAACCTATTTC
ACACAGCCACAGCAGGATGCGAAATGGCGTAAAGATGTCCTGGCCGCGGCGGCGAAAATTGTGACGGAAGGAAAGTAA