PmrF

Accession ARO:3003578
Synonym(s)arnC
CARD Short NamePmrF
DefinitionPmrF is required for the synthesis and transfer of 4-amino-4-deoxy-L-arabinose (Ara4N) to Lipid A, which allows gram-negative bacteria to resist the antimicrobial activity of cationic antimicrobial peptides and antibiotics such as polymyxin. pmrF corresponds to 1 locus in Pseudomonas aeruginosa PAO1 and 1 locus in Pseudomonas aeruginosa LESB58.
AMR Gene Familypmr phosphoethanolamine transferase
Drug Classpeptide antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Perfect MatchesEscherichia colig+p+wgs, Escherichia fergusoniiwgs, Shigella boydiig+wgs, Shigella flexnerig+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Citrobacter amalonaticusg+wgs, Citrobacter freundiig+p+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniig+wgs, Citrobacter youngaeg+wgs, Enterobacter cloacaewgs, Enterobacter hormaecheig+wgs, Enterococcus faeciumwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+wgs, Escherichia marmotaeg+wgs, Klebsiella pneumoniaewgs, Mycobacterium aviumwgs, Raoultella planticolawgs, Salmonella entericag+wgs, Serratia marcescenswgs, Shigella boydiig+wgs, Shigella dysenteriaeg+wgs, Shigella flexnerig+wgs, Shigella sonneig+wgs, Vibrio choleraewgs
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ pmr phosphoethanolamine transferase [AMR Gene Family]
+ regulates cprRS
Sub-Term(s)
1 ontology terms | Show
+ basRS regulates
Publications

Gunn JS, et al. 1998. Mol Microbiol 27(6): 1171-1182. PmrA-PmrB-regulated genes necessary for 4-aminoarabinose lipid A modification and polymyxin resistance. (PMID 9570402)

Resistomes

Prevalence of PmrF among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.04%0%
Citrobacter amalonaticus100%0%87.5%0%
Citrobacter freundii99.23%0.26%59.75%0%
Citrobacter portucalensis100%0%86%0%
Citrobacter werkmanii100%0%100%0%
Citrobacter youngae100%0%100%0%
Enterobacter cloacae0%0%1.36%0%
Enterobacter hormaechei14.88%0%11.33%0%
Enterococcus faecium0%0%0.04%0%
Escherichia albertii100%0%96.55%0%
Escherichia coli61.32%0.04%74.56%0%
Escherichia fergusonii100%0%41.54%0%
Escherichia marmotae100%0%69.05%0%
Klebsiella pneumoniae0%0%0.11%0%
Mycobacterium avium0%0%0.48%0%
Raoultella planticola0%0%2.94%0%
Salmonella enterica93.61%0%87.46%0%
Serratia marcescens0%0%0.15%0%
Shigella boydii57.14%0%59.14%0%
Shigella dysenteriae90.91%0%100%0%
Shigella flexneri100%0%83.5%0%
Shigella sonnei100%0%93.56%0%
Vibrio cholerae0%0%0.07%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 550


>gb|AAC75314.1|+|PmrF [Escherichia coli str. K-12 substr. MG1655]
MFEIHPVKKVSVVIPVYNEQESLPELIRRTTTACESLGKEYEILLIDDGSSDNSAHMLVEASQAENSHIVSILLNRNYGQHSAIMAGFSH
VTGDLIITLDADLQNPPEEIPRLVAKADEGYDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIVDAMLHCHER
STFIPILANIFARRAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSLLGSIIAIGGFSIAVLLVILRLTFGPQWAAEGV
FMLFAVLFTFIGAQFIGMGLLGEYIGRIYTDVRARPRYFVQQVIRPSSKENE


>gb|U00096.1|+|2367071-2368039|PmrF [Escherichia coli str. K-12 substr. MG1655]
ATGTTTGAAATCCACCCTGTTAAGAAAGTCTCGGTGGTTATTCCCGTTTATAACGAGCAGGAAAGCTTACCGGAATTAATCAGGCGCACC
ACCACAGCCTGTGAATCGTTGGGGAAAGAGTATGAGATCCTGCTGATTGATGACGGCAGTAGCGATAATTCCGCGCATATGCTGGTCGAA
GCCTCACAAGCGGAGAACAGCCATATTGTGTCTATTTTGCTTAACCGCAATTACGGGCAACATTCAGCGATTATGGCGGGATTCAGTCAC
GTTACTGGCGACTTAATTATTACCCTTGATGCCGATCTCCAGAATCCGCCAGAAGAAATCCCCCGCCTGGTGGCAAAAGCCGATGAAGGT
TACGACGTGGTAGGGACTGTACGCCAGAACCGCCAGGACAGCTGGTTTCGTAAAACCGCTTCGAAGATGATTAACCGGCTTATTCAGCGC
ACCACTGGCAAAGCGATGGGTGATTACGGTTGTATGCTGCGCGCCTATCGCCGTCATATTGTCGATGCGATGTTGCACTGCCATGAACGC
AGCACCTTTATCCCGATTCTGGCGAATATCTTCGCCCGCCGTGCCATTGAAATTCCAGTACATCATGCCGAGCGTGAGTTTGGTGAATCC
AAATACAGTTTTATGCGCCTGATTAATTTGATGTACGACCTGGTGACCTGCCTTACCACAACGCCGCTACGTATGCTGAGTCTGCTCGGC
AGCATTATTGCGATTGGAGGTTTTAGCATTGCGGTGCTGCTGGTGATTTTACGCCTGACCTTCGGACCACAATGGGCGGCAGAAGGCGTC
TTTATGCTATTTGCCGTGCTGTTTACTTTTATTGGCGCTCAGTTTATCGGCATGGGATTACTCGGTGAATATATCGGCAGGATCTACACC
GATGTCCGCGCCCGCCCCCGCTATTTTGTTCAGCAAGTTATCCGTCCATCCAGCAAGGAAAATGAATAA