efrA

Accession ARO:3003948
CARD Short NameefrA
DefinitionefrA is a part of the EfrAB efflux pump, and both efrA and efrB are necessary to confer drug resistance.
AMR Gene FamilyATP-binding cassette (ABC) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic, macrolide antibiotic, rifamycin antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesEnterococcus faecaliswgs
Resistomes with Sequence VariantsCronobacter sakazakiiwgs, Enterococcus faecalisg+wgs, Klebsiella michiganensiswgs, Staphylococcus haemolyticuswgs
Classification13 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Lavilla Lerma L, et al. 2014. Food Microbiol. 44:249-57 Role of EfrAB efflux pump in biocide tolerance and antibiotic resistance of Enterococcus faecalis and Enterococcus faecium isolated from traditional fermented foods and the effect of EDTA as EfrAB inhibitor. (PMID 25084670)

Lee EW, et al. 2003. Antimicrob Agents Chemother 47(12): 3733-3738. EfrAB, an ABC multidrug efflux pump in Enterococcus faecalis. (PMID 14638474)

Resistomes

Prevalence of efrA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Cronobacter sakazakii0%0%0.24%0%
Enterococcus faecalis96.95%0%48.57%0%
Klebsiella michiganensis0%0%0.3%0%
Staphylococcus haemolyticus0%0%0.22%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 960


>gb|WP_104671188.1|+|efrA [Enterococcus faecalis]
MKLMWRYTMRYKKLLFADFICVFGFILIELGLPTILARMIDKGIIPKDMDYVYQQGIWMVVITIIGVAMNILLGYFGARITTNIVRDIRD
DLFEKIQTFSHSEYESIGVSSLITRTTNDAYQIMLFMGNILRLGFMTPVMFIASLYMVMRTSPSLGMYVLGALPFLLLAVVGIARLSEPL
SKKQQKNLDGINGILRENLSGLRVIRAFVNEKFEESRFNKVNETYTKSSKSLFRLMAAAQPGFFFLFNIVMVLIIWSGTVQISHGDLEVG
NLIAFIEYIFHALFSFMLFASVFMMYPRAAVSASRIQEALDMEPAIREEEGVTETATKGYLEFKNVTFAYPGHAESPVIRNVSFKASPGE
TVAFIGSTGSGKSTLIQLIPRFYDVSEGEILIDGVNVKEYKLSALRNKIGYIPQKALLFTGTIADNLRYGKEDATLEEMERAIDIAQATE
FVSQKPQGYDEPLSEGGTNFSGGQKQRLAIARAIIRNPEIYIFDDSFSALDYQTDANLRARLKKETTESTVLIVAQRVGTIMHADRIVVL
NEGDVVGIGTHRELLETCPIYYDIAASQLSEEELA


>gb|NZ_PTWF01000025.1|+|35859-37586|efrA [Enterococcus faecalis]
TTGAAGTTAATGTGGCGTTACACAATGCGTTATAAGAAATTACTTTTCGCTGATTTTATTTGTGTGTTTGGTTTTATTTTGATTGAATTA
GGCTTGCCGACCATTTTAGCACGAATGATTGACAAAGGAATTATTCCTAAAGATATGGACTATGTTTATCAGCAAGGGATTTGGATGGTT
GTAATTACGATTATTGGTGTCGCAATGAATATTTTGCTAGGGTACTTTGGTGCCAGAATTACAACAAACATTGTTCGTGATATTCGTGAT
GATTTATTTGAAAAGATTCAAACTTTCTCACACAGTGAATATGAAAGTATTGGGGTTTCTTCCTTAATTACGCGAACTACCAATGATGCA
TACCAAATTATGCTCTTCATGGGAAATATTTTACGTCTTGGCTTTATGACGCCAGTGATGTTTATTGCCAGTCTTTACATGGTGATGCGG
ACGAGTCCGTCGTTAGGAATGTACGTTTTAGGTGCCTTGCCTTTTCTACTGCTAGCAGTTGTCGGAATTGCTCGTTTGTCAGAACCGTTA
TCTAAAAAGCAACAAAAGAACTTAGATGGAATCAATGGGATTTTAAGAGAAAATCTTTCTGGATTGCGGGTAATACGCGCATTTGTTAAT
GAAAAATTTGAAGAATCTCGTTTTAATAAAGTCAATGAAACTTACACTAAAAGTTCAAAAAGCCTGTTTCGTTTAATGGCAGCAGCCCAA
CCAGGGTTCTTTTTCTTATTTAATATTGTAATGGTCTTAATCATTTGGAGCGGGACTGTTCAAATCAGCCATGGGGATTTAGAAGTTGGG
AATTTAATAGCTTTTATTGAATATATTTTCCATGCGCTGTTCTCGTTTATGTTATTTGCCAGTGTCTTTATGATGTATCCGCGGGCTGCG
GTTTCGGCTTCGCGGATTCAAGAAGCCTTAGACATGGAACCAGCTATTCGTGAAGAAGAAGGCGTAACAGAAACAGCTACTAAAGGCTAT
CTAGAGTTTAAAAATGTAACCTTTGCCTATCCTGGACATGCGGAAAGCCCAGTCATCCGCAATGTAAGTTTTAAGGCGTCACCTGGTGAA
ACAGTGGCCTTTATTGGGAGCACAGGTAGTGGGAAATCAACATTAATTCAATTGATTCCACGGTTTTATGATGTATCAGAAGGTGAAATT
TTAATCGATGGAGTGAACGTAAAAGAGTACAAACTTAGTGCATTACGCAATAAGATTGGCTATATTCCACAAAAAGCGTTACTTTTTACT
GGTACAATTGCTGATAACCTTCGCTACGGTAAGGAAGATGCGACGTTAGAAGAAATGGAACGAGCAATTGACATTGCTCAAGCTACAGAA
TTTGTTTCACAAAAACCGCAAGGCTATGATGAACCTCTTTCAGAAGGTGGCACGAACTTTTCTGGTGGTCAAAAACAACGTTTAGCTATC
GCACGGGCGATTATTCGCAATCCGGAAATTTATATATTTGATGATAGTTTTTCTGCGTTAGATTATCAAACAGATGCAAATTTACGAGCG
CGTCTGAAAAAAGAAACAACAGAATCCACTGTTTTAATTGTGGCACAACGTGTTGGAACAATTATGCATGCGGACCGCATTGTTGTTTTA
AACGAAGGCGACGTGGTCGGAATTGGCACACATCGTGAATTACTTGAGACTTGTCCAATTTACTATGATATTGCGGCTTCTCAATTGTCA
GAGGAGGAATTAGCATGA