efrB

Accession ARO:3003949
DefinitionefrB is a part of the EfrAB efflux pump, and both efrA and efrB are necessary to confer multidrug resistance.
AMR Gene FamilyATP-binding cassette (ABC) antibiotic efflux pump
Drug Classrifamycin antibiotic, acridine dye, fluoroquinolone antibiotic, nitroimidazole antibiotic, peptide antibiotic, cephalosporin, penam, macrolide antibiotic, tetracycline antibiotic, pleuromutilin antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification22 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Lee EW, et al. 2003. Antimicrob Agents Chemother 47(12): 3733-3738. EfrAB, an ABC multidrug efflux pump in Enterococcus faecalis. (PMID 14638474)

Lavilla Lerma L, et al. 2014. Food Microbiol. 44:249-57 Role of EfrAB efflux pump in biocide tolerance and antibiotic resistance of Enterococcus faecalis and Enterococcus faecium isolated from traditional fermented foods and the effect of EDTA as EfrAB inhibitor. (PMID 25084670)

Resistomes

Prevalence of efrB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis100%0%95.87%
Enterococcus faecium0%0%0.07%
Klebsiella oxytoca0%0%0%
Listeria monocytogenes0%0%0.04%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 710


>gb|CDO61516.1|+|efrB [Enterococcus faecium]
LDTCRIFRRNAKSPVNIAKHAKFIRRLKWLCSENMTGFSVLKLYVRKKKPLKGFKQVNHRFKWFGFKASFISGLMLPLVQMTAYGTYIGV
AVLGSYYVVAGVIVVGQLQAFIQYIWQISQPMGNITQLSAALQSASASTMRIFEILDEPEEELNEQDVPLPEPILGSVEFENVSFSYDPE
KPLIRNLNFKVDAGQMVAIVGPTGAGKTTLINLLMRFYDVTEGAIKIDGIDTKKMNRSDVRSVFGMVLQDAWLYKGTIADNIRFGKLDAT
DYEVVDAAKTANVDHFIRTMPDGYEMEINSEGDNVSLGQKQLLTIARAVISDPKILILDEATSSVDTRLEALIQKAMDRVMEGRTSFVIA
HR


>gb|HG970103.1|+|1-1086|efrB [Enterococcus faecium]
TTAGATACGTGTCGCATATTCAGGAGGAATGCTAAATCACCAGTAAATATTGCAAAGCATGCAAAATTCATTAGGAGACTTAAATGGTTA
TGTTCAGAAAATATGACTGGGTTCAGTGTCTTAAAACTATATGTTCGGAAAAAGAAACCCTTGAAAGGCTTTAAACAAGTCAATCATCGT
TTTAAATGGTTTGGCTTCAAAGCATCCTTTATCTCAGGATTAATGTTGCCATTGGTTCAAATGACCGCTTATGGGACCTATATCGGGGTA
GCTGTCCTTGGTAGTTACTATGTGGTTGCTGGTGTGATCGTAGTGGGGCAGTTACAAGCGTTTATTCAATATATTTGGCAAATTAGCCAA
CCAATGGGGAATATTACGCAGTTGTCTGCAGCTTTACAAAGCGCTTCAGCTTCGACCATGCGGATTTTTGAAATCCTAGATGAACCAGAA
GAAGAACTTAACGAACAAGATGTTCCTTTGCCAGAACCTATTTTAGGCTCTGTTGAATTTGAAAATGTCAGCTTTAGTTATGACCCAGAA
AAACCGTTAATTCGTAATTTGAACTTTAAAGTTGATGCGGGCCAAATGGTTGCGATTGTGGGACCAACTGGCGCTGGGAAAACAACCTTA
ATCAACTTACTGATGCGTTTTTATGATGTAACAGAAGGCGCCATTAAAATTGATGGTATTGACACAAAAAAAATGAACCGTAGTGATGTC
CGATCTGTATTTGGAATGGTATTGCAAGATGCTTGGTTGTATAAAGGTACCATTGCAGATAACATTCGTTTTGGGAAGTTGGATGCCACG
GATTATGAAGTTGTCGATGCAGCGAAAACGGCCAATGTGGATCACTTCATTCGGACAATGCCAGATGGGTATGAAATGGAAATCAATTCT
GAGGGAGATAACGTTTCCCTTGGTCAAAAACAATTGTTGACCATTGCCCGAGCGGTAATTTCTGATCCGAAAATTTTGATTTTAGATGAG
GCGACTAGTTCAGTCGATACACGCTTGGAAGCCTTAATTCAAAAAGCAATGGATCGTGTTATGGAAGGACGAACGAGTTTCGTTATTGCC
CACCGT