Klebsiella pneumoniae OmpK36

Accession ARO:3003968
DefinitionKlebsiella pneumoniae outer membrane porin protein. In beta-lactam-resistant Klebsiella, this porin is often deleted, limiting diffusion of the antibiotic into the cell. Klebsiella strains expressing OmpK36 are often beta-lactam sensitive even in the presence of beta-lactamases because of an inefficient mechanism.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams
Drug Classpenam, carbapenem, cephalosporin, cephamycin, penem, monobactam
Resistance Mechanismreduced permeability to antibiotic, resistance by absence
Classification16 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Sugawara E, et al. 2016. J. Bacteriol. : Klebsiella pneumoniae major porins OmpK35 and OmpK36 allow more efficient diffusion of β-lactams than their Escherichia coli homologs OmpF and OmpC. (PMID 27645385)

Resistomes

Prevalence of Klebsiella pneumoniae OmpK36 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: An AMR detection model for instances where the absence of a protein - due to large-scale insertion elements, large deletions, or other methods of protein knockout - confers clinical resistance to a known antibiotic. These models include reference sequences. Protein knockout models are currently in development.

Bit-score Cut-off (blastP): 650


>gb|YP_005228001.1|-|Klebsiella pneumoniae OmpK36 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
MKVKVLSLLVPALLVAGAANAAEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVGVKGETQINDQLTGYGQWEYNVQANNTESSS
DQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSG
EGALSPTNNGRTALKQNGDGYGTSLTYDIYDGISAGFAYSNSKRLGDQNSKLALGRGDNAETYTGGLKYDANNIYLATQYTQTYNATRAG
SLGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDLEGYGDQDILKYVDVGATYYFNKNMSTYVDYKINLLDDNSFTHNAGISTDDVVA
LGLVYQF


>gb|NC_016845.1|-|3727882-3728985|Klebsiella pneumoniae OmpK36 [Klebsiella pneumoniae subsp. pneumoniae HS11286]
ATGAAAGTTAAAGTACTGTCCCTCCTGGTACCGGCTCTGCTGGTAGCAGGCGCAGCAAATGCGGCTGAAATTTATAACAAAGACGGCAAC
AAATTAGACCTGTACGGTAAAATTGACGGTCTGCACTACTTCTCTGACGACAAGAGCGTCGACGGCGACCAGACCTACATGCGTGTAGGC
GTGAAAGGCGAAACCCAGATCAACGACCAGCTGACCGGTTACGGCCAGTGGGAATACAACGTTCAGGCGAACAACACTGAAAGCTCCAGC
GATCAGGCATGGACTCGTCTGGCATTCGCAGGCCTGAAATTTGGCGACGCGGGCTCTTTCGACTACGGTCGTAACTACGGCGTAGTATAC
GACGTAACGTCCTGGACCGACGTTCTGCCGGAATTCGGCGGCGACACCTACGGTTCTGACAACTTCCTGCAGTCCCGTGCTAACGGCGTT
GCAACCTACCGTAACTCTGATTTCTTCGGTCTGGTTGACGGCCTGAACTTTGCTCTGCAGTATCAGGGTAAAAACGGCAGCGTCAGCGGC
GAAGGCGCTCTGTCTCCTACCAACAACGGTCGTACCGCCTTGAAACAGAACGGCGACGGTTACGGTACTTCTCTGACCTATGACATCTAT
GATGGCATCAGCGCTGGTTTCGCATACTCTAACTCCAAACGTCTTGGCGACCAGAACAGCAAGCTGGCACTGGGTCGTGGCGACAACGCT
GAAACCTACACCGGCGGTCTGAAATACGACGCGAACAACATCTACCTGGCCACTCAGTACACCCAGACCTACAACGCGACCCGCGCCGGT
TCCCTGGGCTTTGCTAACAAAGCGCAGAACTTCGAAGTGGTTGCTCAGTACCAGTTCGACTTCGGTCTGCGTCCGTCCGTGGCTTACCTG
CAGTCTAAAGGTAAGGATCTGGAAGGCTACGGCGACCAGGACATCCTGAAATATGTTGACGTTGGCGCGACCTACTACTTCAACAAAAAC
ATGTCCACCTATGTTGACTACAAAATCAACCTGCTGGACGACAATAGCTTCACCCACAACGCCGGTATCTCTACCGACGACGTGGTTGCA
CTGGGCCTGGTTTACCAGTTCTAA