Klebsiella pneumoniae OmpK37

Accession ARO:3004122
CARD Short NameKpne_OmpK37
DefinitionKlebsiella pneumoniae outer membrane porin protein. Is preferentially detected in porin-deficient strains. Functional characterization of this new porin revealed a narrower pore than those of porins OmpK35 and OmpK36, which did not allow penetration by certain beta-lactams. Also, when a resistant strain expresses porin OmpK37 is less susceptible to cefotaxime and cefoxitin than when it is expressing either OmpK36 or OmpK35.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams
Drug Classpenem, cephalosporin, cephamycin, penam, carbapenem, monobactam
Resistance Mechanismreduced permeability to antibiotic
Resistomes with Sequence VariantsKlebsiella aerogenesg, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaeg+wgs
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic cefotaxime [Antibiotic]
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ General Bacterial Porin with reduced permeability to beta-lactams [AMR Gene Family]
Publications

Doménech-Sánchez A, et al. 1999. J. Bacteriol. 181(9):2726-32 Identification and characterization of a new porin gene of Klebsiella pneumoniae: its role in beta-lactam antibiotic resistance. (PMID 10217760)

Resistomes

Prevalence of Klebsiella pneumoniae OmpK37 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Klebsiella aerogenes2%0%0%0%
Klebsiella pneumoniae98.7%0.03%56.48%0%
Klebsiella quasipneumoniae88.24%0%71.97%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700

Type of Antibiotic Resistance: Intrinsic or chromosomally-encoded


>gb|CAA09666.1|+|Klebsiella pneumoniae OmpK37 [Klebsiella pneumoniae]
MKRKVLALVIPALLAAGAAHAAEIYNKDGNKLDLYGKVDGLHYFSSDSKKDGDQTYLRFGFKGETQINDILTGYGQWEYNVQANNTETSS
DQAWTRLAFAGIKVGDYGSFDYGRNYGVLYDVEGWTDILPEFGGDSYTYADNFMAGRANGVATYRNSDFFGLVEGLNFALQYQGKNEGQN
AQDINVGTNNRSSDSDVRFDNGDGFGLSTSYDFGMGISAAAAYTSSDRTNDQMTQTNARGDKAEAWTAGLKYDANDIYLATMYSETRNMT
PYGNDGVANKTQNFEVTAQYQFDFGLRPAISYLQSKGKDLYNNGRYADKDLVKYMDVGATYYFNRNMSTYVDYKINLLDGNDKFYEDNGI
STDNIVALGLVYQF


>gb|AJ011502.1|+|301-1425|Klebsiella pneumoniae OmpK37 [Klebsiella pneumoniae]
ATGAAAAGAAAAGTACTGGCCCTCGTTATTCCGGCTTTATTAGCCGCCGGTGCCGCGCATGCGGCGGAAATTTATAATAAAGACGGGAAT
AAATTAGATCTCTATGGCAAGGTAGATGGTCTGCATTATTTCTCCAGCGACTCGAAAAAAGACGGCGATCAAACTTATTTACGTTTTGGC
TTTAAAGGCGAAACCCAGATCAACGATATTCTTACCGGCTATGGCCAGTGGGAATATAACGTTCAGGCCAACAACACCGAGACCTCCAGC
GATCAGGCGTGGACCCGTCTGGCATTCGCCGGTATCAAAGTGGGCGATTACGGCTCCTTCGACTACGGTCGTAACTACGGCGTGCTGTAC
GACGTTGAAGGCTGGACCGATATTCTGCCGGAGTTCGGCGGCGACTCCTACACCTATGCGGATAACTTTATGGCAGGCCGCGCCAACGGC
GTCGCAACCTACCGCAACAGCGATTTTTTCGGTCTGGTGGAGGGTCTGAACTTCGCCCTGCAGTATCAGGGTAAAAACGAAGGCCAGAAC
GCGCAGGATATCAACGTCGGCACCAATAACCGCAGCAGCGACAGCGATGTTCGCTTCGACAATGGCGATGGTTTCGGCCTCTCTACTTCC
TACGACTTCGGCATGGGCATCAGCGCGGCGGCAGCTTACACCTCGTCTGACCGTACTAACGATCAGATGACCCAGACCAACGCGCGCGGC
GATAAAGCGGAAGCCTGGACCGCCGGCCTGAAGTACGACGCCAACGATATCTACCTGGCGACCATGTACTCTGAAACCCGCAATATGACC
CCGTACGGCAATGACGGCGTGGCCAATAAAACACAAAACTTCGAAGTCACCGCGCAGTATCAGTTCGACTTCGGCCTGCGTCCGGCCATC
TCCTACCTGCAGTCCAAAGGCAAAGATCTGTACAATAACGGCCGCTATGCCGATAAAGATCTGGTCAAATATATGGACGTTGGCGCGACC
TATTACTTCAACCGTAATATGTCCACCTATGTTGATTACAAAATCAACCTGCTGGATGGTAACGACAAATTCTACGAAGACAACGGTATC
TCTACCGATAACATCGTCGCCCTGGGCCTGGTTTACCAGTTCTGA