cfrC

Accession ARO:3004146
Synonym(s)cfr(C)
DefinitionA cfr-like 23S rRNA methyltransferase shown to confer resistance to linezolid and phenicol antibiotics, including florfenicol and chloramphenicol, in Clostridium.
AMR Gene FamilyCfr 23S ribosomal RNA methyltransferase
Drug Classoxazolidinone antibiotic, phenicol antibiotic, streptogramin antibiotic, lincosamide antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic target alteration
ResistomesClostridium botulinumg+wgs
Classification22 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic florfenicol [Antibiotic]
+ cfr(C) Group
Publications

Candela T, et al. 2017. Int. J. Antimicrob. Agents 50(3):496-500 A cfr-Like Gene cfr(C) Conferring Linezolid Resistance is Common in Clostridium difficile. (PMID 28663118)

Resistomes

Prevalence of cfrC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Clostridium botulinum80%0%68.6%
Vibrio parahaemolyticus0%0%0.08%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|CAL84423.1|-|cfrC [Clostridium botulinum A str. ATCC 3502]
MKQTKTKYGKMKQIASNLKLPDYRYEQLTKAIFHQRIDNFHDMHILPKALRIALVNEFGKNVSSVTPIFSQDSKQAQKLLFELTDGERIE
AVGLKYKQGWESFCISSQCGCSFGCRFCATGSAGFKRNLTADEITDQLLYFYFNDHRLNSISFMGMGEAFANPELFDAVKILTDQNLFGL
SQRRITISTIGIIPGIQRLTKEFPQVNLAFSLHSPFESQRSDLMPINKRFPLNEVMKTLDEHIIHTGRRVFIAYIMLEGINDSKEHAEAI
IGLLRNRGSWEHLYHIDLIPYNSTDKTTFKFQSSSAIKQFCSTLKKASISATVRTQFGSEISAACGQLCYENEL


>gb|AM412317.1|-|3035493-3036527|cfrC [Clostridium botulinum A str. ATCC 3502]
ATGAAACAGACAAAAACGAAATATGGAAAAATGAAACAAATAGCATCGAATTTAAAATTACCTGATTATAGATACGAACAGCTTACAAAA
GCTATTTTTCATCAAAGAATAGATAATTTTCATGATATGCATATACTACCAAAAGCGTTAAGGATAGCTTTAGTAAATGAGTTTGGAAAG
AATGTATCTAGTGTAACACCTATTTTTTCACAAGATTCTAAACAAGCTCAAAAGTTGTTATTTGAATTGACTGATGGAGAAAGAATAGAA
GCCGTTGGACTAAAGTATAAACAGGGGTGGGAATCGTTTTGTATTTCTTCCCAATGTGGTTGTAGTTTTGGATGTCGTTTTTGTGCAACG
GGAAGTGCTGGATTTAAACGCAATCTTACTGCTGATGAGATAACTGACCAATTACTTTATTTCTATTTTAATGACCATAGATTGAATAGT
ATTTCATTTATGGGAATGGGTGAGGCTTTTGCAAATCCAGAGTTATTTGATGCAGTAAAAATTTTAACTGATCAAAATTTATTTGGGTTA
AGTCAACGAAGAATTACTATTTCAACAATTGGCATTATACCAGGAATTCAAAGACTGACTAAAGAATTTCCACAAGTGAATCTGGCTTTT
TCACTTCATTCACCATTTGAAAGTCAACGAAGCGATTTAATGCCTATAAATAAAAGATTTCCATTGAATGAGGTAATGAAGACATTAGAT
GAACATATCATTCATACGGGACGACGAGTGTTTATTGCTTATATTATGCTTGAAGGAATTAATGATTCGAAAGAACATGCAGAGGCAATT
ATAGGTTTATTGAGAAATCGTGGTTCATGGGAGCATTTATATCACATTGATTTGATACCTTATAATTCTACGGACAAAACAACTTTTAAA
TTTCAATCTTCAAGTGCTATCAAGCAATTTTGCAGTACACTAAAGAAAGCTAGTATTAGTGCAACTGTTAGAACACAATTTGGTTCTGAA
ATTAGTGCTGCTTGCGGACAATTGTGTTATGAAAATGAATTATGA