aphA15

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004675
CARD Short NameaphA15
DefinitionExpression of cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin, as well as to amikacin, netilmicin, and streptomycin.
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification11 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic neomycin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ APH(3')-I
Resistomes with Perfect MatchesAeromonas veroniiwgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogenesp+wgs, Klebsiella pneumoniaep+wgs, Pseudomonas aeruginosawgs
Resistomes with Sequence VariantsAeromonas veroniiwgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogenesp+wgs, Klebsiella pneumoniaep+wgs, Pseudomonas aeruginosawgs, Pseudomonas putidawgs, Solilutibacter oculig
Publications

Riccio ML, et al. 2001. Antimicrob. Agents Chemother. 45(4):1249-53 In70 of plasmid pAX22, a bla(VIM-1)-containing integron carrying a new aminoglycoside phosphotransferase gene cassette. (PMID 11257042)

Resistomes

Prevalence of aphA15 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas veronii0%0%0.56%0%0%
Citrobacter freundii0%0%1.35%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Enterobacter asburiae0%0%2.37%0%0%
Enterobacter cloacae0%0.56%0.96%0%0%
Enterobacter hormaechei0%0.06%0.91%0%0%
Enterobacter kobei0%0.69%0%0%0%
Enterobacter roggenkampii0%0%1.08%0%0%
Escherichia coli0%0.01%0.05%0%0%
Klebsiella aerogenes0%1.09%0.28%0%0%
Klebsiella pneumoniae0%0.03%0.12%0%0%
Pseudomonas aeruginosa0%0%1.52%0%0%
Pseudomonas putida0%0%0.53%0%0%
Solilutibacter oculi100%0%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAD91341.1|+|aphA15 [Pseudomonas aeruginosa]
MTVALDEVSELKNLLSPLLDECTFEEVEYGQSDARVIRVLFPDRNTAYLKYASGSSAQEILQEHQRTRWLRTRALVPEVISYVSTSTVTI
LLTKALIGHNAADAADADPVIVVAEMARALRDLHSISPDDCPFDERLHLRLKLASGRLEAGLVDEEDFDHARQGMLARDVYEQLFIQMPG
AEQLVVTHGDACPENFIFQGNAFVGFIDCGRVGLADKYQDLALASRNIDAVFGPELTNQFFIEYGEPNPNIAKIEYYRILDEFF


>gb|Y18050.2|+|4758-5552|aphA15 [Pseudomonas aeruginosa]
ATGACAGTCGCCCTCGACGAAGTATCTGAACTAAAGAATTTGCTTTCACCCTTGTTGGATGAATGCACTTTTGAAGAAGTTGAGTATGGT
CAGTCAGATGCTCGAGTGATTCGAGTTCTATTTCCTGATCGCAATACCGCGTATCTAAAGTACGCCTCCGGATCTTCTGCTCAAGAAATT
CTTCAAGAGCATCAGCGCACTAGATGGCTCAGAACACGAGCTCTCGTACCGGAAGTGATCTCATATGTCTCGACTTCAACTGTCACCATC
CTGTTGACAAAAGCATTGATTGGCCACAATGCCGCTGACGCCGCAGATGCAGATCCAGTTATTGTTGTTGCAGAGATGGCACGAGCGTTA
CGCGACCTCCATTCGATCTCGCCTGACGATTGCCCATTCGACGAAAGGCTCCACCTGCGACTGAAGCTGGCTTCGGGCCGTTTGGAAGCC
GGGTTAGTTGATGAGGAGGACTTTGATCACGCAAGGCAAGGCATGCTGGCGCGGGATGTTTACGAGCAACTTTTTATACAAATGCCTGGA
GCGGAGCAGCTGGTAGTCACACATGGCGACGCCTGTCCCGAGAACTTCATCTTCCAAGGTAATGCCTTCGTCGGCTTCATAGACTGCGGT
CGGGTCGGGCTTGCCGATAAGTATCAAGACCTGGCGCTTGCATCGAGAAACATTGACGCGGTATTTGGACCAGAACTCACTAACCAGTTC
TTCATCGAGTATGGAGAGCCAAATCCGAACATAGCTAAGATTGAGTACTACCGGATCTTGGATGAGTTCTTCTAA

Curator Acknowledgements
Curator Description Most Recent Edit