aphA15

Accession ARO:3004675
DefinitionExpression of cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin, as well as to amikacin, netilmicin, and streptomycin
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesCitrobacter youngaewgs, Enterobacter hormaecheip+wgs, Escherichia coliwgs, Klebsiella aerogenesp, Klebsiella pneumoniaep+wgs, Pseudomonas aeruginosawgs
Resistomes with Sequence VariantsCitrobacter freundiip, Citrobacter youngaewgs, Enterobacter hormaecheip+wgs, Escherichia coliwgs, Klebsiella aerogenesp, Klebsiella pneumoniaeg+p+wgs, Pseudomonas aeruginosag+wgs
Classification11 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic neomycin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ APH(3') [AMR Gene Family]
Publications

Riccio ML, et al. 2001. Antimicrob. Agents Chemother. 45(4):1249-53 In70 of plasmid pAX22, a bla(VIM-1)-containing integron carrying a new aminoglycoside phosphotransferase gene cassette. (PMID 11257042)

Resistomes

Prevalence of aphA15 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii0%0.94%0%
Citrobacter youngae0%0%12.5%
Enterobacter hormaechei0%0.55%0.49%
Escherichia coli0%0%0.04%
Klebsiella aerogenes0%2%0%
Klebsiella pneumoniae0.2%0.09%0.13%
Pseudomonas aeruginosa0.77%0%0.95%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|CAD91341.1|+|aphA15 [Pseudomonas aeruginosa]
MTVALDEVSELKNLLSPLLDECTFEEVEYGQSDARVIRVLFPDRNTAYLKYASGSSAQEILQEHQRTRWLRTRALVPEVISYVSTSTVTI
LLTKALIGHNAADAADADPVIVVAEMARALRDLHSISPDDCPFDERLHLRLKLASGRLEAGLVDEEDFDHARQGMLARDVYEQLFIQMPG
AEQLVVTHGDACPENFIFQGNAFVGFIDCGRVGLADKYQDLALASRNIDAVFGPELTNQFFIEYGEPNPNIAKIEYYRILDEFF


>gb|Y18050.2|+|4758-5552|aphA15 [Pseudomonas aeruginosa]
ATGACAGTCGCCCTCGACGAAGTATCTGAACTAAAGAATTTGCTTTCACCCTTGTTGGATGAATGCACTTTTGAAGAAGTTGAGTATGGT
CAGTCAGATGCTCGAGTGATTCGAGTTCTATTTCCTGATCGCAATACCGCGTATCTAAAGTACGCCTCCGGATCTTCTGCTCAAGAAATT
CTTCAAGAGCATCAGCGCACTAGATGGCTCAGAACACGAGCTCTCGTACCGGAAGTGATCTCATATGTCTCGACTTCAACTGTCACCATC
CTGTTGACAAAAGCATTGATTGGCCACAATGCCGCTGACGCCGCAGATGCAGATCCAGTTATTGTTGTTGCAGAGATGGCACGAGCGTTA
CGCGACCTCCATTCGATCTCGCCTGACGATTGCCCATTCGACGAAAGGCTCCACCTGCGACTGAAGCTGGCTTCGGGCCGTTTGGAAGCC
GGGTTAGTTGATGAGGAGGACTTTGATCACGCAAGGCAAGGCATGCTGGCGCGGGATGTTTACGAGCAACTTTTTATACAAATGCCTGGA
GCGGAGCAGCTGGTAGTCACACATGGCGACGCCTGTCCCGAGAACTTCATCTTCCAAGGTAATGCCTTCGTCGGCTTCATAGACTGCGGT
CGGGTCGGGCTTGCCGATAAGTATCAAGACCTGGCGCTTGCATCGAGAAACATTGACGCGGTATTTGGACCAGAACTCACTAACCAGTTC
TTCATCGAGTATGGAGAGCCAAATCCGAACATAGCTAAGATTGAGTACTACCGGATCTTGGATGAGTTCTTCTAA