aphA15

Download Sequences

Accession	ARO:3004675
CARD Short Name	aphA15
Definition	Expression of cloned aphA15 gene in Escherichia coli reduced the susceptibility to kanamycin and neomycin, as well as to amikacin, netilmicin, and streptomycin.
AMR Gene Family	APH(3')
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Aeromonas veronii^wgs, Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella pneumoniae^p+wgs, Pseudomonas aeruginosa^wgs
Resistomes with Sequence Variants	Aeromonas veronii^wgs, Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella pneumoniae^p+wgs, Lysobacter oculi^g, Pseudomonas aeruginosa^wgs, Pseudomonas putida^wgs
Classification	11 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + determinant of antibiotic resistance + antibiotic inactivation enzyme + antibiotic molecule + aminoglycoside modifying enzyme + phosphorylation of antibiotic conferring resistance + aminoglycoside phosphotransferase (APH) + aminoglycoside antibiotic [Drug Class] + APH(3') [AMR Gene Family]
Parent Term(s)	6 ontology terms \| Show + confers_resistance_to_antibiotic kanamycin A [Antibiotic] + confers_resistance_to_antibiotic netilmicin [Antibiotic] + confers_resistance_to_antibiotic neomycin [Antibiotic] + confers_resistance_to_antibiotic streptomycin [Antibiotic] + confers_resistance_to_antibiotic amikacin [Antibiotic] + APH(3')-I
Publications	Riccio ML, et al. 2001. Antimicrob. Agents Chemother. 45(4):1249-53 In70 of plasmid pAX22, a bla(VIM-1)-containing integron carrying a new aminoglycoside phosphotransferase gene cassette. (PMID 11257042)

Resistomes

Prevalence of aphA15 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Aeromonas veronii	0%	0%	0.56%	0%
Aeromonas veronii	0%	0%	0.56%	0%
Citrobacter freundii	0%	0%	0.58%	0%
Citrobacter freundii	0%	0%	0.58%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Enterobacter asburiae	0%	0%	1.19%	0%
Enterobacter asburiae	0%	0%	1.19%	0%
Enterobacter cloacae	0%	0.56%	0.64%	0%
Enterobacter cloacae	0%	0.56%	0.64%	0%
Enterobacter hormaechei	0%	0.06%	0.43%	0%
Enterobacter hormaechei	0%	0.06%	0.43%	0%
Enterobacter kobei	0%	0.69%	0%	0%
Enterobacter kobei	0%	0.69%	0%	0%
Enterobacter roggenkampii	0%	0%	1.08%	0%
Enterobacter roggenkampii	0%	0%	1.08%	0%
Escherichia coli	0%	0.01%	0.04%	0%
Escherichia coli	0%	0.01%	0.04%	0%
Klebsiella aerogenes	0%	1.09%	0.28%	0%
Klebsiella aerogenes	0%	1.09%	0.28%	0%
Klebsiella pneumoniae	0%	0.03%	0.12%	0%
Klebsiella pneumoniae	0%	0.03%	0.12%	0%
Lysobacter oculi	100%	0%	0%	0%
Lysobacter oculi	0%	0%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.97%	0%
Pseudomonas aeruginosa	0%	0%	0.8%	0%
Pseudomonas putida	0%	0%	0%	0%
Pseudomonas putida	0%	0%	0.53%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|CAD91341.1|+|aphA15 [Pseudomonas aeruginosa]
MTVALDEVSELKNLLSPLLDECTFEEVEYGQSDARVIRVLFPDRNTAYLKYASGSSAQEILQEHQRTRWLRTRALVPEVISYVSTSTVTI
LLTKALIGHNAADAADADPVIVVAEMARALRDLHSISPDDCPFDERLHLRLKLASGRLEAGLVDEEDFDHARQGMLARDVYEQLFIQMPG
AEQLVVTHGDACPENFIFQGNAFVGFIDCGRVGLADKYQDLALASRNIDAVFGPELTNQFFIEYGEPNPNIAKIEYYRILDEFF

>gb|Y18050.2|+|4758-5552|aphA15 [Pseudomonas aeruginosa]
ATGACAGTCGCCCTCGACGAAGTATCTGAACTAAAGAATTTGCTTTCACCCTTGTTGGATGAATGCACTTTTGAAGAAGTTGAGTATGGT
CAGTCAGATGCTCGAGTGATTCGAGTTCTATTTCCTGATCGCAATACCGCGTATCTAAAGTACGCCTCCGGATCTTCTGCTCAAGAAATT
CTTCAAGAGCATCAGCGCACTAGATGGCTCAGAACACGAGCTCTCGTACCGGAAGTGATCTCATATGTCTCGACTTCAACTGTCACCATC
CTGTTGACAAAAGCATTGATTGGCCACAATGCCGCTGACGCCGCAGATGCAGATCCAGTTATTGTTGTTGCAGAGATGGCACGAGCGTTA
CGCGACCTCCATTCGATCTCGCCTGACGATTGCCCATTCGACGAAAGGCTCCACCTGCGACTGAAGCTGGCTTCGGGCCGTTTGGAAGCC
GGGTTAGTTGATGAGGAGGACTTTGATCACGCAAGGCAAGGCATGCTGGCGCGGGATGTTTACGAGCAACTTTTTATACAAATGCCTGGA
GCGGAGCAGCTGGTAGTCACACATGGCGACGCCTGTCCCGAGAACTTCATCTTCCAAGGTAATGCCTTCGTCGGCTTCATAGACTGCGGT
CGGGTCGGGCTTGCCGATAAGTATCAAGACCTGGCGCTTGCATCGAGAAACATTGACGCGGTATTTGGACCAGAACTCACTAACCAGTTC
TTCATCGAGTATGGAGAGCCAAATCCGAACATAGCTAAGATTGAGTACTACCGGATCTTGGATGAGTTCTTCTAA

aphA15

Prevalence: protein homolog model (view sequences)

Graph