rmtD2

Accession ARO:3004677
CARD Short NamermtD2
DefinitionThe first allele of a 16S rRNA methyltransferase gene, rmtD2, confers a high resistance to all clinically available aminoglycosides.
AMR Gene Family16S rRNA methyltransferase (G1405)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Perfect MatchesAeromonas hydrophilawgs, Enterobacter hormaecheiwgs
Resistomes with Sequence VariantsAeromonas hydrophilawgs, Enterobacter hormaecheiwgs
Classification10 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin A [Antibiotic]
+ 16S rRNA methyltransferase (G1405) [AMR Gene Family]
Publications

Tijet N, et al. 2011. Antimicrob. Agents Chemother. 55(2):904-9 rmtD2, a new allele of a 16S rRNA methylase gene, has been present in Enterobacteriaceae isolates from Argentina for more than a decade. (PMID 21078935)

Resistomes

Prevalence of rmtD2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Aeromonas hydrophila0%0%1%0%
Enterobacter hormaechei0%0%0.05%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|ADW66527.1|-|rmtD2 [Klebsiella aerogenes]
MSELKEKLLASKKYRDVCPDTIERIWRECSAKFKKEKDADKAAREALHGVTGAFMTEREYKRAMELAATRDWEALLGMHASTRERLPVES
MDRVFDQLFEAIGTPARILDLACGLNPVYLAHRLPNAAIAGVDISGQCVNVIRAFGGAEARLGDLLCEIPEDEADAALMFKVLPLLERQR
TGAAMEALMRVNAEWIVASFPTRSLGGRNVGMEKHYSEWMEAHVPENRAIAARLTGENELFYVLKRK


>gb|HQ401565.1|-|14139-14882|rmtD2 [Klebsiella aerogenes]
ATGAGCGAACTGAAGGAAAAACTGCTCGCTTCGAAAAAATATCGCGACGTTTGCCCGGACACGATCGAGCGCATATGGCGTGAATGCAGC
GCGAAATTCAAAAAGGAAAAGGACGCGGACAAGGCGGCGCGCGAAGCGCTTCACGGTGTGACCGGCGCGTTCATGACCGAGCGCGAATAC
AAACGCGCGATGGAACTGGCGGCGACACGCGATTGGGAAGCGCTGCTTGGAATGCACGCGTCCACGCGCGAACGGCTGCCGGTGGAATCG
ATGGATCGCGTGTTCGATCAGCTGTTTGAAGCCATCGGAACGCCGGCGCGAATTCTCGATCTCGCGTGCGGGCTGAATCCGGTCTACCTC
GCGCATCGATTGCCAAATGCGGCGATTGCCGGCGTGGATATCAGCGGTCAGTGCGTAAACGTAATTCGCGCGTTTGGCGGCGCGGAAGCG
CGTTTGGGCGATTTGCTGTGCGAAATTCCGGAAGACGAAGCGGATGCGGCGCTGATGTTTAAGGTGCTGCCGCTTTTGGAGCGCCAGCGC
ACGGGCGCGGCGATGGAAGCGCTAATGCGTGTGAATGCGGAATGGATCGTCGCATCGTTTCCGACGCGTTCACTCGGCGGGCGCAACGTC
GGCATGGAAAAGCACTATTCCGAATGGATGGAGGCGCACGTGCCGGAAAATCGCGCGATTGCCGCGCGGCTGACCGGCGAAAACGAGCTG
TTTTACGTGCTGAAACGAAAATGA