MCR-9.1

Download Sequences

Accession	ARO:3004684
Synonym(s)	MCR-9
CARD Short Name	MCR-9.1
Definition	A mobilized and plasmid-mediated colistin resistance gene and phosphoethanolamine transferase identified from a Salmonella enterica isolate.
AMR Gene Family	MCR phosphoethanolamine transferase
Drug Class	peptide antibiotic
Resistance Mechanism	antibiotic target alteration
Resistomes with Perfect Matches	Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p+wgs, Citrobacter werkmanii^wgs, Cronobacter malonaticus^wgs, Cronobacter sakazakii^wgs, Enterobacter asburiae^g+p+wgs, Enterobacter cancerogenus^p, Enterobacter cloacae^g+p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^g+p+wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+p+wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Raoultella planticola^wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^p+wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p+wgs, Citrobacter werkmanii^wgs, Cronobacter malonaticus^wgs, Cronobacter sakazakii^wgs, Enterobacter asburiae^g+p+wgs, Enterobacter cancerogenus^p, Enterobacter cloacae^g+p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^g+p+wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+p+wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Raoultella planticola^wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^p+wgs
Classification	14 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + peptide antibiotic [Drug Class] + mechanism of antibiotic resistance + lipopeptide antibiotic + antibiotic target alteration [Resistance Mechanism] + charge alteration conferring antibiotic resistance + determinant of antibiotic resistance + polymyxin antibiotic + gene altering cell wall charge + colistin + phosphoethanolamine transferase conferring colistin resistance + colistin B [Antibiotic] + colistin A [Antibiotic]
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic colistin A [Antibiotic] + confers_resistance_to_antibiotic colistin B [Antibiotic] + MCR phosphoethanolamine transferase [AMR Gene Family]
Publications	Carroll LM, et al. 2019. MBio 10(3): Identification of Novel Mobilized Colistin Resistance Gene mcr-9 in a Multidrug-Resistant, Colistin-Susceptible Salmonella enterica Serotype Typhimurium Isolate. (PMID 31064835)

Resistomes

Prevalence of MCR-9.1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	0%	0%	9.09%	0%	0%
Citrobacter amalonaticus	0%	0%	9.09%	0%	0%
Citrobacter freundii	0%	0%	11.61%	0%	0%
Citrobacter freundii	0%	0%	4.06%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter portucalensis	0%	1.47%	11.71%	0%	0%
Citrobacter portucalensis	0%	1.47%	10.81%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Cronobacter malonaticus	0%	0%	5.45%	0%	0%
Cronobacter malonaticus	0%	0%	5.45%	0%	0%
Cronobacter sakazakii	0%	0%	5.61%	0%	0%
Cronobacter sakazakii	0%	0%	5.61%	0%	0%
Enterobacter asburiae	19.35%	0.55%	14.23%	0%	0%
Enterobacter asburiae	19.35%	0.83%	19.76%	0%	0%
Enterobacter cancerogenus	0%	25%	0%	0%	0%
Enterobacter cancerogenus	0%	25%	0%	0%	0%
Enterobacter cloacae	3.57%	4.47%	17.57%	0%	0%
Enterobacter cloacae	3.57%	2.23%	10.86%	0%	0%
Enterobacter hormaechei	1.8%	4.76%	21.8%	0%	0%
Enterobacter hormaechei	1.8%	3.73%	16.57%	0%	0%
Enterobacter kobei	22.73%	2.76%	21.4%	0%	0%
Enterobacter kobei	22.73%	2.07%	14.41%	0%	0%
Enterobacter roggenkampii	0%	1.45%	16.55%	0%	0%
Enterobacter roggenkampii	0%	0.48%	5.04%	0%	0%
Escherichia coli	0%	0%	0.29%	0%	0%
Escherichia coli	0%	0%	0.19%	0%	0%
Klebsiella michiganensis	0%	0%	0.8%	0%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Klebsiella oxytoca	0%	2.05%	0.84%	0%	0%
Klebsiella oxytoca	0%	2.05%	0.84%	0%	0%
Klebsiella pneumoniae	0%	0%	0.21%	0%	0%
Klebsiella pneumoniae	0%	0%	0.3%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.39%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.39%	0%	0%
Leclercia adecarboxylata	21.43%	4.76%	41.86%	0%	0%
Leclercia adecarboxylata	7.14%	4.76%	34.88%	0%	0%
Morganella morganii	0%	0%	1.23%	0%	0%
Morganella morganii	0%	0%	1.23%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Raoultella planticola	0%	0%	2.56%	0%	0%
Raoultella planticola	0%	0%	2.56%	0%	0%
Salmonella enterica	0.13%	0.11%	0.57%	0%	0%
Salmonella enterica	0.13%	0.11%	0.6%	0%	0%
Serratia marcescens	0%	1.94%	0.26%	0%	0%
Serratia marcescens	0%	2.58%	3.8%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 1000

Protein
DNA

>gb|WP_001572373.1|+|MCR-9.1 [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]
MPVLFRVKVIPLVLLLAMIFAFLLNWPILLHFYEILSHLEHVKIGFVISIPFVLVAALNVVFMPFSVRFLLKPFFALLFITGSLVSYSTL
KYKVMFDQTMIQNIIETNPQEAHSYLNGSIIIWFVFTGILPAILLFSIKIQYPEKWYKGIAYRLLSVLASLSLIAGVAALYYQDYASVGR
NNSTLNKEIIPANYAYSTFQYVKDTYFTTKVPFQTLGNDAKRVVAHEKPTLMFLVIGETARSQNFSMNGYSRDTNAFTSKSGGVISFKNM
HSCGTATAISVPCMFSNMNRTEYDSKKASNSENFLDIVQKTGVSLLWKENDGGCKGVCSRIPTVEIKPSDNPKLCDGKTCHDEVMLENLD
DEIAKMPGDKLVAFHIIGSHGPTYYLRYPAEHRHFMPECARSDIENCTQEQLVNTYDNTLRYTDYVLAEMIEKLKNYSDQYNTVLLYVSD
HGESLGESGLYLHGTPYKLAPDQQTHIPMQVWMSPGFIAGKHINMSCLENNAAKKSYSHDNLFSSILGLWDVSTSVYNPDRDLFRECRG

>gb|NC_021819.1|+|16014-17633|MCR-9.1 [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]
ATGCCTGTACTTTTCAGGGTGAAAGTTATTCCGCTGGTTTTACTTCTGGCAATGATCTTTGCGTTTTTACTTAACTGGCCAATATTGCTG
CATTTTTACGAGATTTTGTCGCATTTAGAGCATGTCAAAATTGGTTTTGTCATTTCTATTCCCTTTGTTCTGGTTGCGGCGCTTAACGTT
GTTTTTATGCCTTTCTCAGTTCGTTTTCTGCTGAAACCTTTCTTTGCTTTACTGTTTATCACTGGCTCACTGGTCAGTTATTCGACACTA
AAATATAAAGTAATGTTTGATCAAACGATGATTCAAAACATTATTGAAACTAACCCCCAGGAAGCGCATTCCTATCTTAATGGCTCAATT
ATTATATGGTTCGTCTTTACCGGTATCCTTCCTGCCATCCTCCTTTTTTCAATAAAAATTCAATATCCTGAAAAATGGTATAAAGGCATT
GCTTACCGTTTGCTCTCCGTGCTGGCATCGTTGAGTTTGATTGCAGGTGTTGCCGCACTTTATTATCAGGATTATGCCTCTGTCGGCCGC
AATAACTCGACATTGAATAAAGAGATCATCCCGGCGAACTACGCTTACAGCACTTTCCAGTATGTTAAGGATACGTACTTTACGACTAAA
GTGCCTTTCCAGACGCTGGGGAATGATGCTAAACGCGTCGTCGCTCACGAAAAACCCACGCTGATGTTCCTGGTGATTGGCGAAACGGCA
CGCAGCCAGAATTTCTCGATGAACGGTTATTCGCGTGATACCAATGCCTTTACCAGCAAATCCGGCGGCGTTATTTCGTTTAAAAATATG
CATTCCTGCGGTACCGCTACCGCAATATCCGTTCCGTGCATGTTCTCGAATATGAATCGCACCGAGTACGACAGTAAAAAAGCATCTAAC
AGTGAAAATTTCCTCGACATCGTGCAGAAAACCGGTGTCTCGCTGTTATGGAAAGAGAACGATGGCGGTTGTAAAGGCGTATGTAGCCGC
ATCCCGACTGTCGAAATTAAGCCTAGTGATAACCCGAAACTGTGCGATGGCAAAACGTGCCATGACGAGGTGATGCTGGAAAACCTTGAT
GATGAAATCGCCAAAATGCCAGGTGATAAGCTTGTCGCCTTCCATATCATTGGCAGCCATGGACCGACTTATTACCTGCGTTATCCGGCT
GAGCATCGCCACTTCATGCCCGAATGTGCACGTAGCGATATCGAAAACTGTACTCAGGAACAATTGGTCAACACCTACGACAACACCCTT
CGTTATACAGACTATGTATTAGCTGAGATGATTGAAAAGCTAAAAAATTACAGCGATCAGTACAACACCGTGCTGCTTTATGTGTCCGAT
CATGGTGAATCATTGGGCGAAAGCGGGCTATATCTGCACGGCACGCCGTACAAACTGGCACCGGATCAGCAGACGCATATTCCGATGCAG
GTCTGGATGTCACCGGGCTTTATCGCCGGGAAACACATCAACATGTCTTGCCTTGAAAATAATGCGGCGAAAAAATCATATTCCCACGAC
AACCTGTTCTCATCGATTTTGGGGCTGTGGGACGTAAGCACCAGCGTCTATAATCCTGACCGCGATTTGTTCCGCGAATGCCGTGGCTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

MCR-9.1

Prevalence: protein homolog model (view sequences)

Graph