MCR-9.1

Accession ARO:3004684
Synonym(s)MCR-9
DefinitionA mobilized and plasmid-mediated colistin resistance gene and phosphoethanolamine transferase identified from a Salmonella enterica isolate
AMR Gene FamilyMCR phosphoethanolamine transferase
Drug Classpeptide antibiotic
Resistance Mechanismantibiotic target alteration
ResistomesCitrobacter freundiip+wgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeig+p+wgs, Escherichia coliwgs, Klebsiella oxytocap+wgs, Proteus mirabiliswgs, Salmonella entericag+p+wgs, Serratia marcescenswgs
Classification15 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic polymyxin antibiotic
+ confers_resistance_to_antibiotic colistin A [Antibiotic]
+ confers_resistance_to_antibiotic colistin B [Antibiotic]
+ MCR phosphoethanolamine transferase [AMR Gene Family]
Publications

Carroll LM, et al. 2019. MBio 10(3): Identification of Novel Mobilized Colistin Resistance Gene mcr-9 in a Multidrug-Resistant, Colistin-Susceptible Salmonella enterica Serotype Typhimurium Isolate. (PMID 31064835)

Resistomes

Prevalence of MCR-9.1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii0%2.33%3.88%
Enterobacter asburiae0%0%23.44%
Enterobacter cloacae0%3.9%22.57%
Enterobacter hormaechei2.7%10.81%16.32%
Enterobacter kobei33.33%20%26.56%
Escherichia coli0%0%0.19%
Klebsiella oxytoca0%5%4.67%
Proteus mirabilis0%0%0.86%
Salmonella enterica0.39%0.7%0.6%
Serratia marcescens0%1.64%0.46%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1000


>gb|WP_001572373.1|+|MCR-9 [Enterobacteriales]
MPVLFRVKVIPLVLLLAMIFAFLLNWPILLHFYEILSHLEHVKIGFVISIPFVLVAALNVVFMPFSVRFLLKPFFALLFITGSLVSYSTL
KYKVMFDQTMIQNIIETNPQEAHSYLNGSIIIWFVFTGILPAILLFSIKIQYPEKWYKGIAYRLLSVLASLSLIAGVAALYYQDYASVGR
NNSTLNKEIIPANYAYSTFQYVKDTYFTTKVPFQTLGNDAKRVVAHEKPTLMFLVIGETARSQNFSMNGYSRDTNAFTSKSGGVISFKNM
HSCGTATAISVPCMFSNMNRTEYDSKKASNSENFLDIVQKTGVSLLWKENDGGCKGVCSRIPTVEIKPSDNPKLCDGKTCHDEVMLENLD
DEIAKMPGDKLVAFHIIGSHGPTYYLRYPAEHRHFMPECARSDIENCTQEQLVNTYDNTLRYTDYVLAEMIEKLKNYSDQYNTVLLYVSD
HGESLGESGLYLHGTPYKLAPDQQTHIPMQVWMSPGFIAGKHINMSCLENNAAKKSYSHDNLFSSILGLWDVSTSVYNPDRDLFRECRG


>gb|NC_021819.1|+|16014-17633|MCR-9 [Enterobacteriales]
ATGCCTGTACTTTTCAGGGTGAAAGTTATTCCGCTGGTTTTACTTCTGGCAATGATCTTTGCGTTTTTACTTAACTGGCCAATATTGCTG
CATTTTTACGAGATTTTGTCGCATTTAGAGCATGTCAAAATTGGTTTTGTCATTTCTATTCCCTTTGTTCTGGTTGCGGCGCTTAACGTT
GTTTTTATGCCTTTCTCAGTTCGTTTTCTGCTGAAACCTTTCTTTGCTTTACTGTTTATCACTGGCTCACTGGTCAGTTATTCGACACTA
AAATATAAAGTAATGTTTGATCAAACGATGATTCAAAACATTATTGAAACTAACCCCCAGGAAGCGCATTCCTATCTTAATGGCTCAATT
ATTATATGGTTCGTCTTTACCGGTATCCTTCCTGCCATCCTCCTTTTTTCAATAAAAATTCAATATCCTGAAAAATGGTATAAAGGCATT
GCTTACCGTTTGCTCTCCGTGCTGGCATCGTTGAGTTTGATTGCAGGTGTTGCCGCACTTTATTATCAGGATTATGCCTCTGTCGGCCGC
AATAACTCGACATTGAATAAAGAGATCATCCCGGCGAACTACGCTTACAGCACTTTCCAGTATGTTAAGGATACGTACTTTACGACTAAA
GTGCCTTTCCAGACGCTGGGGAATGATGCTAAACGCGTCGTCGCTCACGAAAAACCCACGCTGATGTTCCTGGTGATTGGCGAAACGGCA
CGCAGCCAGAATTTCTCGATGAACGGTTATTCGCGTGATACCAATGCCTTTACCAGCAAATCCGGCGGCGTTATTTCGTTTAAAAATATG
CATTCCTGCGGTACCGCTACCGCAATATCCGTTCCGTGCATGTTCTCGAATATGAATCGCACCGAGTACGACAGTAAAAAAGCATCTAAC
AGTGAAAATTTCCTCGACATCGTGCAGAAAACCGGTGTCTCGCTGTTATGGAAAGAGAACGATGGCGGTTGTAAAGGCGTATGTAGCCGC
ATCCCGACTGTCGAAATTAAGCCTAGTGATAACCCGAAACTGTGCGATGGCAAAACGTGCCATGACGAGGTGATGCTGGAAAACCTTGAT
GATGAAATCGCCAAAATGCCAGGTGATAAGCTTGTCGCCTTCCATATCATTGGCAGCCATGGACCGACTTATTACCTGCGTTATCCGGCT
GAGCATCGCCACTTCATGCCCGAATGTGCACGTAGCGATATCGAAAACTGTACTCAGGAACAATTGGTCAACACCTACGACAACACCCTT
CGTTATACAGACTATGTATTAGCTGAGATGATTGAAAAGCTAAAAAATTACAGCGATCAGTACAACACCGTGCTGCTTTATGTGTCCGAT
CATGGTGAATCATTGGGCGAAAGCGGGCTATATCTGCACGGCACGCCGTACAAACTGGCACCGGATCAGCAGACGCATATTCCGATGCAG
GTCTGGATGTCACCGGGCTTTATCGCCGGGAAACACATCAACATGTCTTGCCTTGAAAATAATGCGGCGAAAAAATCATATTCCCACGAC
AACCTGTTCTCATCGATTTTGGGGCTGTGGGACGTAAGCACCAGCGTCTATAATCCTGACCGCGATTTGTTCCGCGAATGCCGTGGCTAA