AAC(6')-Ib-cr5

Accession ARO:3005115
CARD Short NameAAC(6')-Ib-cr5
DefinitionA fluoroquinolone-acetylating aminoglycoside acetyltransferase variant identified from Pseudomonas. These proteins confer resistance to both fluoroquinolone and aminoglycoside antibiotics.
AMR Gene FamilyAAC(6'), AAC(6')-Ib-cr
Drug Classaminoglycoside antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesCitrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Salmonella entericawgs, Serratia marcescenswgs, Shigella boydiiwgs, Shigella sonneiwgs
Resistomes with Sequence VariantsCitrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia rettgeriwgs, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Salmonella entericawgs, Serratia marcescenswgs, Shigella boydiiwgs, Shigella sonneiwgs
Classification12 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ AAC(6')-Ib-cr [AMR Gene Family]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
Publications

Lebreton F, et al. 2021. JAC Antimicrob Resist 3(4):dlab179 A panel of diverse Pseudomonas aeruginosa clinical isolates for research and development. (PMID 34909689)

Resistomes

Prevalence of AAC(6')-Ib-cr5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Citrobacter freundii0%0%0.77%0%
Citrobacter portucalensis0%0%2.7%0%
Citrobacter werkmanii0%0%10.26%0%
Enterobacter asburiae0%0%1.19%0%
Enterobacter chengduensis0%0%8%0%
Enterobacter cloacae0%0%5.43%0%
Enterobacter hormaechei0%0%3.71%0%
Enterobacter kobei0%0%0.87%0%
Escherichia coli0%0.01%1.51%0%
Klebsiella aerogenes0%0%1.69%0%
Klebsiella michiganensis0%0%1.06%0%
Klebsiella oxytoca0%0%1.68%0%
Klebsiella pneumoniae0%0.16%5.17%0%
Klebsiella quasipneumoniae0%0%6.05%0%
Morganella morganii0%0%1.84%0%
Proteus mirabilis0%0%0.99%0%
Providencia rettgeri0%0%2.55%0%
Pseudomonas aeruginosa0%0%0.01%0%
Raoultella planticola0%0%2.56%0%
Salmonella enterica0%0%0.03%0%
Serratia marcescens0%0%1.97%0%
Shigella boydii0%0%2.22%0%
Shigella sonnei0%0%0.51%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|ABX24471.1|+|AAC(6')-Ib-cr5 [Pseudomonas aeruginosa]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEE
ETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERT
RSDA


>gb|EU161636.1|+|1022-1576|AAC(6')-Ib-cr5 [Pseudomonas aeruginosa]
GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGAAGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA