AAC(6')-Ib-cr5

Download Sequences

Accession	ARO:3005115
CARD Short Name	AAC(6')-Ib-cr5
Definition	A fluoroquinolone-acetylating aminoglycoside acetyltransferase variant identified from Pseudomonas. These proteins confer resistance to both fluoroquinolone and aminoglycoside antibiotics.
AMR Gene Family	AAC(6'), AAC(6')-Ib-cr
Drug Class	aminoglycoside antibiotic, fluoroquinolone antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Enterobacter asburiae^wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Escherichia coli^p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Raoultella planticola^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs, Shigella boydii^wgs, Shigella sonnei^wgs
Resistomes with Sequence Variants	Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Enterobacter asburiae^wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Escherichia coli^p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Raoultella planticola^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs, Shigella boydii^wgs, Shigella sonnei^wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + aminoglycoside modifying enzyme + acylation of antibiotic conferring resistance + antibiotic molecule + aminoglycoside acetyltransferase (AAC) + aminoglycoside antibiotic [Drug Class] + AAC(6') [AMR Gene Family] + fluoroquinolone antibiotic [Drug Class]
Parent Term(s)	5 ontology terms \| Show + confers_resistance_to_antibiotic amikacin [Antibiotic] + confers_resistance_to_antibiotic ciprofloxacin [Antibiotic] + confers_resistance_to_antibiotic kanamycin A [Antibiotic] + confers_resistance_to_antibiotic tobramycin [Antibiotic] + AAC(6')-Ib-cr [AMR Gene Family]
Publications	Lebreton F, et al. 2021. JAC Antimicrob Resist 3(4):dlab179 A panel of diverse Pseudomonas aeruginosa clinical isolates for research and development. (PMID 34909689)

Resistomes

Prevalence of AAC(6')-Ib-cr5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter freundii	0%	0%	0.77%	0%	0%
Citrobacter freundii	0%	0%	0.77%	0%	0%
Citrobacter portucalensis	0%	0%	3.6%	0%	0%
Citrobacter portucalensis	0%	0%	3.6%	0%	0%
Citrobacter werkmanii	0%	0%	33.33%	0%	0%
Citrobacter werkmanii	0%	0%	33.33%	0%	0%
Enterobacter asburiae	0%	0%	1.58%	0%	0%
Enterobacter asburiae	0%	0%	1.19%	0%	0%
Enterobacter chengduensis	0%	0%	8%	0%	0%
Enterobacter chengduensis	0%	0%	8%	0%	0%
Enterobacter cloacae	0%	0%	6.71%	0%	0%
Enterobacter cloacae	0%	0%	6.71%	0%	0%
Enterobacter hormaechei	0%	0%	5.39%	0%	0%
Enterobacter hormaechei	0%	0%	5.39%	0%	0%
Enterobacter kobei	0%	0%	1.31%	0%	0%
Enterobacter kobei	0%	0%	1.31%	0%	0%
Escherichia coli	0%	0.01%	2.2%	0%	0%
Escherichia coli	0%	0.01%	2.21%	0%	0%
Klebsiella aerogenes	0%	0%	1.69%	0%	0%
Klebsiella aerogenes	0%	0%	1.69%	0%	0%
Klebsiella michiganensis	0%	0%	4.52%	0%	0%
Klebsiella michiganensis	0%	0%	4.52%	0%	0%
Klebsiella oxytoca	0%	0%	2.1%	0%	0%
Klebsiella oxytoca	0%	0%	2.1%	0%	0%
Klebsiella pneumoniae	0%	0.16%	8.01%	0%	0%
Klebsiella pneumoniae	0%	0.16%	7.84%	0%	0%
Klebsiella quasipneumoniae	0%	0%	6.05%	0%	0%
Klebsiella quasipneumoniae	0%	0%	6.05%	0%	0%
Morganella morganii	0%	0%	1.84%	0%	0%
Morganella morganii	0%	0%	1.84%	0%	0%
Proteus mirabilis	0%	0%	0.99%	0%	0%
Proteus mirabilis	0%	0%	0.99%	0%	0%
Providencia rettgeri	0%	0%	2.55%	0%	0%
Providencia rettgeri	0%	0%	2.55%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Raoultella planticola	0%	0%	2.56%	0%	0%
Raoultella planticola	0%	0%	2.56%	0%	0%
Salmonella enterica	0%	0%	0.03%	0%	0%
Salmonella enterica	0%	0%	0.03%	0%	0%
Serratia marcescens	0%	0%	2.36%	0%	0%
Serratia marcescens	0%	0%	2.36%	0%	0%
Shigella boydii	0%	0%	2.22%	0%	0%
Shigella boydii	0%	0%	2.22%	0%	0%
Shigella sonnei	0%	0%	0.51%	0%	0%
Shigella sonnei	0%	0%	0.51%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300

Protein
DNA

>gb|ABX24471.1|+|AAC(6')-Ib-cr5 [Pseudomonas aeruginosa]
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEE
ETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERT
RSDA

>gb|EU161636.1|+|1022-1576|AAC(6')-Ib-cr5 [Pseudomonas aeruginosa]
GTGACCAACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGAAGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

AAC(6')-Ib-cr5

Prevalence: protein homolog model (view sequences)

Graph