AAC(6')-Ib-cr6

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3005116
CARD Short NameAAC(6')-Ib-cr6
DefinitionA fluoroquinolone-acetylating aminoglycoside acetyltransferase variant identified from Escherichia coli. These proteins confer resistance to both fluoroquinolone and aminoglycoside antibiotics.
AMR Gene FamilyAAC(6'), AAC(6')-Ib-cr
Drug Classaminoglycoside antibiotic, fluoroquinolone antibiotic
Resistance Mechanismantibiotic inactivation
Classification12 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6')-Ib-cr [AMR Gene Family]
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Acinetobacter nosocomialiswgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+p+wgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaewgs, Enterobacter asburiaeg+p+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesg+p+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisp+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaeg+p+wgs, Laribacter hongkongensisg+wgs, Leclercia adecarboxylatap+wgs, Morganella morganiig+p+wgs, Proteus mirabilisg+p+wgs, Proteus penneriwgs, Providencia alcalifaciensg, Providencia rettgerig+p+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Pseudomonas putidap, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella boydiiwgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Vibrio choleraep+wgs
Publications

Tegha G, et al. 2021. Microb Genom 7(1): Genomic epidemiology of Escherichia coli isolates from a tertiary referral center in Lilongwe, Malawi. (PMID 33295867)

Resistomes

Prevalence of AAC(6')-Ib-cr6 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.17%0%0%
Acinetobacter nosocomialis0%0%0.57%0%0%
Aeromonas caviae2.27%2.6%5.91%0%0%
Aeromonas hydrophila3.08%1.3%1.61%0%0%
Aeromonas veronii5.45%1.54%2.25%0%0%
Citrobacter amalonaticus0%8.33%10.91%0%0%
Citrobacter freundii0%8.92%23.21%0%0%
Citrobacter koseri0%15%7.21%0%0%
Citrobacter portucalensis0%16.18%14.41%0%0%
Citrobacter werkmanii0%10%28.21%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae3.23%0.83%2.77%0%0%
Enterobacter chengduensis0%0%8%0%0%
Enterobacter cloacae1.79%1.68%6.07%0%0%
Enterobacter hormaechei1.8%2.57%11.09%0%0%
Enterobacter kobei0%1.38%3.93%0%0%
Enterobacter roggenkampii0%0.48%1.8%0%0%
Escherichia coli0.93%1.43%4.86%0%0%
Escherichia fergusonii0%0.36%2.17%0%0%
Klebsiella aerogenes2%5.43%2.54%0%0%
Klebsiella huaxiensis100%0%0%0%0%
Klebsiella michiganensis0%10.86%9.57%0%0%
Klebsiella oxytoca2.56%6.16%1.68%0%0%
Klebsiella pneumoniae4.79%5.4%17.13%0%0%
Klebsiella quasipneumoniae0.84%2.97%10.39%0%0%
Laribacter hongkongensis66.67%0%12.5%0%0%
Leclercia adecarboxylata0%9.52%4.65%0%0%
Morganella morganii25%5%15.34%0%0%
Proteus mirabilis33.94%7.5%28.55%0%0%
Proteus penneri0%0%25%0%0%
Providencia alcalifaciens18.18%0%0%0%0%
Providencia rettgeri5.88%5.41%1.27%0%0%
Providencia stuartii0%0%9.09%0%0%
Pseudomonas aeruginosa0%0%0.2%0%0%
Pseudomonas putida0%4%0%0%0%
Raoultella planticola0%11.63%12.82%0%0%
Salmonella enterica1.14%3.56%2%0%0%
Serratia marcescens0%1.29%0.92%0%0%
Shigella boydii0%0%1.11%0%0%
Shigella flexneri0%3.21%0.47%0%0%
Shigella sonnei0%0%0.22%0%0%
Vibrio cholerae0%5.26%0.13%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|WP_063840320.1|+|AAC(6')-Ib-cr6 [Escherichia coli]
MTNCNDSVTLRLMTEHDLAMLYGWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEE
ETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERT
RSDA


>gb|NG_047292.1|+|101-655|AAC(6')-Ib-cr6 [Escherichia coli]
GTGACCAACTGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGGGTGGCTAAATCGATCTCATATC
GTCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGAGTCCGTC
ACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACGGACGGTGGGAAGAA
GAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCTTGGGAACCAAGCTGGTTCGAGCT
CTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCGAGCAACTTGCGAGCGATCCGATGCTACGAG
AAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCATATGGTCCAGCCGTGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACA
CGCAGTGATGCCTAA

Curator Acknowledgements
Curator Description Most Recent Edit