tetO

Accession ARO:3000190
DefinitionTetO is a ribosomal protection protein. It is associated with conjugative plasmids.
AMR Gene Familytetracycline-resistant ribosomal protection protein
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic target protection
ResistomesCampylobacter colip+wgs, Campylobacter jejunip+wgs
Classification8 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ tetracycline-resistant ribosomal protection protein [AMR Gene Family]
+ confers_resistance_to_drug tetracycline [Antibiotic]
+ confers_resistance_to_drug doxycycline [Antibiotic]
+ confers_resistance_to_drug minocycline [Antibiotic]
+ confers_resistance_to_drug chlortetracycline [Antibiotic]
+ confers_resistance_to_drug demeclocycline [Antibiotic]
+ confers_resistance_to_drug oxytetracycline [Antibiotic]
Publications

Luna VA and Roberts MC. 1998. J Antimicrob Chemother 42(5): 613-619. The presence of the tetO gene in a variety of tetracycline-resistant Streptococcus pneumoniae serotypes from Washington State. (PMID 9848445)

LeBlanc DJ, et al. 1988. J Bacteriol 170(8): 3618-3626. Nucleotide sequence analysis of tetracycline resistance gene tetO from Streptococcus mutans DL5. (PMID 2841293)

Resistomes

Prevalence of tetO among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Campylobacter coli0%10%29.68%
Campylobacter jejuni4.93%21.05%36.24%
Clostridioides difficile1.54%0%0.22%
Enterococcus faecalis0%0%0.4%
Enterococcus faecium0%0%0.17%
Staphylococcus aureus0%0%0.09%
Streptococcus agalactiae6.78%0%11.09%
Streptococcus anginosus0%0%2.44%
Streptococcus pneumoniae0%0%0.14%
Streptococcus pyogenes1.67%0%0.58%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1200


>gb|AAA23033.2|+|tetO [Campylobacter jejuni]
MKIINLGILAHVDAGKTTLTESLLYTSGAIAELGSVDEGTTRTDTMNLERQRGITIQTAVTSFQWEDVKVNIIDTPGHMDFLAEVYRSLS
VLDGAVLLVSAKDGIQAQTRILFHALQIMKIPTIFFINKIDQEGIDLPMVYREMKAKLSSEIIVKQKVGQHPHINVTDNDDMEQWDAVIM
GNDELLEKYMSGKPFKMSELEQEENRRFQNGTLFPVYHGSAKNNLGTRQLIEVIASKFYSSTPEGQSELCGQVFKIEYSEKRRRFVYVRI
YSGTLHLRDVIRISEKEKIKITEMYVPTNGELYSSDTACSGDIVILPNDVLQLNSILGNEILLPQRKFIENPLPMIQTTIAVKKSEQREI
LLGALTEISDCDPLLKYYVDTTTHEIILSFLGNVQMEVICAILEEKYHVEAEIKEPTVIYMERPLRKAEYTIHIEVPPNPFWASVGLSIE
PLPIGSGVQYESRVSLGYLNQSFQNAVMEGVLYGCEQGLYGWKVTDCKICFEYGLYYSPVSTPADFRLLSPIVLEQALKKAGTELLEPYL
HFEIYAPQEYLSRAYHDAPRYCADIVSTQIKNDEVILKGEIPARCIQEYRNDLTYFTNGQGVCLTELKGYQPAIGKFICQPRRPNSRIDK
VRHMFHKLA


>gb|M18896.2|+|207-2126|tetO [Campylobacter jejuni]
ATGAAAATAATTAACTTAGGCATTCTGGCTCACGTTGACGCAGGAAAGACAACATTAACGGAAAGTTTATTGTATACCAGTGGTGCAATT
GCAGAACTAGGGAGCGTAGATGAAGGCACAACAAGGACAGATACAATGAATTTGGAGCGTCAAAGGGGAATCACTATCCAGACAGCAGTG
ACATCTTTTCAGTGGGAGGATGTAAAAGTCAACATTATAGATACGCCAGGCCATATGGATTTTTTGGCGGAAGTATACCGTTCTTTATCC
GTATTAGACGGAGCAGTATTATTAGTTTCTGCAAAGGATGGCATACAGGCACAGACCCGTATACTGTTTCATGCACTACAGATAATGAAG
ATTCCGACAATTTTTTTCATCAATAAAATTGACCAAGAGGGGATTGATTTGCCAATGGTATATCGGGAAATGAAAGCAAAGCTTTCTTCG
GAAATTATAGTGAAGCAAAAGGTTGGGCAGCATCCCCATATAAATGTAACGGACAATGACGATATGGAACAGTGGGATGCGGTAATTATG
GGAAACGATGAACTATTAGAGAAATATATGTCAGGGAAACCGTTTAAAATGTCAGAACTGGAACAGGAAGAAAACAGGAGATTCCAAAAC
GGAACGTTATTTCCCGTTTATCACGGAAGCGCTAAAAACAATCTGGGGACTCGGCAGCTTATAGAAGTAATTGCCAGTAAATTTTATTCA
TCAACGCCTGAAGGTCAATCTGAACTATGCGGGCAGGTTTTTAAGATTGAATATTCAGAGAAAAGGCGGCGTTTTGTTTATGTGCGTATA
TATAGCGGAACATTGCATTTGAGGGATGTTATTAGAATATCTGAAAAAGAGAAAATAAAAATCACAGAGATGTATGTTCCGACAAACGGT
GAATTATATTCATCCGATACAGCCTGCTCTGGTGATATTGTAATTTTACCAAATGATGTTTTGCAGCTAAACAGTATTTTGGGGAACGAA
ATACTGTTGCCGCAGAGAAAATTTATTGAAAATCCTCTCCCTATGATCCAAACAACGATTGCAGTAAAGAAATCTGAACAGCGGGAAATA
TTGCTTGGGGCACTTACAGAAATTTCAGATTGCGACCCTCTTTTAAAATATTATGTGGATACTACAACGCATGAGATTATACTTTCTTTT
TTGGGGAATGTGCAGATGGAAGTCATTTGTGCCATCCTTGAGGAAAAATATCATGTGGAGGCAGAAATAAAAGAGCCTACTGTTATATAT
ATGGAAAGACCGCTTAGAAAAGCAGAATATACCATCCACATAGAAGTCCCGCCAAATCCTTTCTGGGCTTCTGTCGGGTTGTCCATAGAG
CCGCTCCCTATTGGAAGCGGAGTGCAGTATGAAAGCAGAGTTTCACTTGGATATTTAAATCAATCGTTCCAAAATGCGGTTATGGAGGGG
GTTCTTTATGGCTGCGAGCAGGGGCTGTATGGATGGAAAGTGACAGACTGTAAAATCTGTTTTGAATATGGATTGTATTATAGTCCTGTA
AGTACCCCCGCAGACTTTCGGCTGCTTTCCCCTATCGTATTGGAGCAGGCTTTAAAAAAAGCAGGGACAGAACTATTAGAGCCATATCTC
CACTTTGAAATTTATGCACCGCAGGAATATCTCTCACGGGCGTATCATGATGCTCCAAGGTATTGTGCAGATATTGTAAGTACTCAGATA
AAGAATGACGAGGTCATTCTGAAAGGAGAAATCCCTGCTAGATGTATTCAAGAATACAGGAACGATTTAACTTATTTCACAAATGGGCAG
GGAGTCTGCTTGACAGAGTTAAAAGGATACCAGCCAGCTATTGGTAAATTTATTTGCCAACCCCGCCGCCCGAATAGCCGTATAGATAAG
GTTCGGCATATGTTCCACAAGTTAGCTTAA