tet(O)

Download Sequences

Accession	ARO:3000190
Synonym(s)	tetO
CARD Short Name	tet(O)
Definition	Tet(O) is a ribosomal protection protein. It is associated with conjugative plasmids.
AMR Gene Family	tetracycline-resistant ribosomal protection protein
Drug Class	tetracycline antibiotic
Resistance Mechanism	antibiotic target protection
Resistomes with Perfect Matches	Campylobacter coli^g+p+wgs, Campylobacter fetus^wgs, Campylobacter jejuni^p+wgs, Campylobacter upsaliensis^wgs
Resistomes with Sequence Variants	Actinobacillus pleuropneumoniae^g, Anaerostipes hadrus^wgs, Bifidobacterium bifidum^wgs, Bifidobacterium breve^g+wgs, Bifidobacterium longum^wgs, Blautia producta^wgs, Campylobacter coli^g+p+wgs, Campylobacter concisus^wgs, Campylobacter fetus^wgs, Campylobacter jejuni^g+p+wgs, Campylobacter upsaliensis^wgs, Corynebacterium amycolatum^wgs, Corynebacterium diphtheriae^wgs, Eggerthella lenta^g+wgs, Enterocloster clostridioformis^g+wgs, Enterococcus faecalis^p+wgs, Enterococcus faecium^wgs, Enterococcus hirae^wgs, Erysipelatoclostridium ramosum^wgs, Eubacterium limosum^wgs, Eubacterium maltosivorans^wgs, Faecalibacterium prausnitzii^g+wgs, Fusobacterium necrophorum^wgs, Gordonibacter urolithinfaciens^wgs, Helicobacter pullorum^wgs, Mobiluncus mulieris^wgs, Pasteurella multocida^wgs, Roseburia hominis^wgs, Ruthenibacterium lactatiformans^wgs, Salmonella enterica^p+wgs, Staphylococcus aureus^wgs, Staphylococcus pseudintermedius^wgs, Streptococcus agalactiae^g+wgs, Streptococcus anginosus^g+wgs, Streptococcus canis^g+wgs, Streptococcus constellatus^wgs, Streptococcus dysgalactiae^g+wgs, Streptococcus equi^wgs, Streptococcus gallolyticus^wgs, Streptococcus gordonii^wgs, Streptococcus iniae^wgs, Streptococcus intermedius^wgs, Streptococcus mitis^wgs, Streptococcus pasteurianus^g+wgs, Streptococcus pneumoniae^wgs, Streptococcus porcinus^g+wgs, Streptococcus pseudopneumoniae^wgs, Streptococcus pyogenes^g+wgs, Streptococcus sanguinis^wgs, Streptococcus suis^g+wgs, Streptococcus uberis^wgs
Classification	7 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic target protection [Resistance Mechanism] + antibiotic target protection protein + tetracycline antibiotic [Drug Class]
Parent Term(s)	7 ontology terms \| Show + tetracycline-resistant ribosomal protection protein [AMR Gene Family] + confers_resistance_to_antibiotic tetracycline [Antibiotic] + confers_resistance_to_antibiotic doxycycline [Antibiotic] + confers_resistance_to_antibiotic minocycline [Antibiotic] + confers_resistance_to_antibiotic chlortetracycline [Antibiotic] + confers_resistance_to_antibiotic demeclocycline [Antibiotic] + confers_resistance_to_antibiotic oxytetracycline [Antibiotic]
Publications	Luna VA and Roberts MC. 1998. J Antimicrob Chemother 42(5): 613-619. The presence of the tetO gene in a variety of tetracycline-resistant Streptococcus pneumoniae serotypes from Washington State. (PMID 9848445) LeBlanc DJ, et al. 1988. J Bacteriol 170(8): 3618-3626. Nucleotide sequence analysis of tetracycline resistance gene tetO from Streptococcus mutans DL5. (PMID 2841293)

Resistomes

Prevalence of tet(O) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Actinobacillus pleuropneumoniae	5.56%	0%	0%	0%	0%
Actinobacillus pleuropneumoniae	0%	0%	0%	0%	0%
Anaerostipes hadrus	0%	0%	29.31%	0%	0%
Anaerostipes hadrus	0%	0%	0%	0%	0%
Bifidobacterium bifidum	0%	0%	2.99%	0%	0%
Bifidobacterium bifidum	0%	0%	0%	0%	0%
Bifidobacterium breve	9.8%	0%	15.06%	0%	0%
Bifidobacterium breve	0%	0%	0%	0%	0%
Bifidobacterium longum	0%	0%	0.21%	0%	0%
Bifidobacterium longum	0%	0%	0%	0%	0%
Blautia producta	0%	0%	18.18%	0%	0%
Blautia producta	0%	0%	0%	0%	0%
Campylobacter coli	1.45%	4.55%	2.29%	0%	0%
Campylobacter coli	26.09%	20%	47.76%	0%	0%
Campylobacter concisus	0%	0%	0.45%	0%	0%
Campylobacter concisus	0%	0%	0%	0%	0%
Campylobacter fetus	0%	0%	1.33%	0%	0%
Campylobacter fetus	0%	0%	1.33%	0%	0%
Campylobacter jejuni	0%	13.86%	1.51%	0%	0%
Campylobacter jejuni	12.28%	40.59%	38.26%	0%	0%
Campylobacter upsaliensis	0%	0%	5.6%	0%	0%
Campylobacter upsaliensis	0%	0%	8%	0%	0%
Corynebacterium amycolatum	0%	0%	7.41%	0%	0%
Corynebacterium amycolatum	0%	0%	0%	0%	0%
Corynebacterium diphtheriae	0%	0%	5.96%	0%	0%
Corynebacterium diphtheriae	0%	0%	0%	0%	0%
Eggerthella lenta	40%	0%	19.79%	0%	0%
Eggerthella lenta	0%	0%	0%	0%	0%
Enterocloster clostridioformis	0%	0%	0%	0%	0%
Enterocloster clostridioformis	100%	0%	46.51%	0%	0%
Enterococcus faecalis	0%	0.25%	1.52%	0%	0%
Enterococcus faecalis	0%	0%	0%	0%	0%
Enterococcus faecium	0%	0%	0.27%	0%	0%
Enterococcus faecium	0%	0%	0%	0%	0%
Enterococcus hirae	0%	0%	0%	0%	0%
Enterococcus hirae	0%	0%	4.17%	0%	0%
Erysipelatoclostridium ramosum	0%	0%	0%	0%	0%
Erysipelatoclostridium ramosum	0%	0%	3.49%	0%	0%
Eubacterium limosum	0%	0%	0%	0%	0%
Eubacterium limosum	0%	0%	25%	0%	0%
Eubacterium maltosivorans	0%	0%	33.33%	0%	0%
Eubacterium maltosivorans	0%	0%	0%	0%	0%
Faecalibacterium prausnitzii	13.33%	0%	6.8%	0%	0%
Faecalibacterium prausnitzii	0%	0%	0%	0%	0%
Fusobacterium necrophorum	0%	0%	0%	0%	0%
Fusobacterium necrophorum	0%	0%	4.65%	0%	0%
Gordonibacter urolithinfaciens	0%	0%	0%	0%	0%
Gordonibacter urolithinfaciens	0%	0%	9.09%	0%	0%
Helicobacter pullorum	0%	0%	3.45%	0%	0%
Helicobacter pullorum	0%	0%	0%	0%	0%
Mobiluncus mulieris	0%	0%	0%	0%	0%
Mobiluncus mulieris	0%	0%	58.82%	0%	0%
Pasteurella multocida	0%	0%	0.75%	0%	0%
Pasteurella multocida	0%	0%	0%	0%	0%
Roseburia hominis	0%	0%	0%	0%	0%
Roseburia hominis	0%	0%	44.44%	0%	0%
Ruthenibacterium lactatiformans	0%	0%	6.67%	0%	0%
Ruthenibacterium lactatiformans	0%	0%	0%	0%	0%
Salmonella enterica	0%	0.05%	0.02%	0%	0%
Salmonella enterica	0%	0%	0%	0%	0%
Staphylococcus aureus	0%	0%	0.05%	0%	0%
Staphylococcus aureus	0%	0%	0%	0%	0%
Staphylococcus pseudintermedius	0%	0%	0%	0%	0%
Staphylococcus pseudintermedius	0%	0%	0.26%	0%	0%
Streptococcus agalactiae	12.15%	0%	15.14%	0%	0%
Streptococcus agalactiae	0%	0%	0%	0%	0%
Streptococcus anginosus	11.76%	0%	25.73%	0%	0%
Streptococcus anginosus	0%	0%	0%	0%	0%
Streptococcus canis	0%	0%	0%	0%	0%
Streptococcus canis	16.67%	0%	6.67%	0%	0%
Streptococcus constellatus	0%	0%	4.55%	0%	0%
Streptococcus constellatus	0%	0%	0%	0%	0%
Streptococcus dysgalactiae	6%	0%	7.48%	0%	0%
Streptococcus dysgalactiae	0%	0%	0%	0%	0%
Streptococcus equi	0%	0%	0%	0%	0%
Streptococcus equi	0%	0%	1.13%	0%	0%
Streptococcus gallolyticus	0%	0%	6.82%	0%	0%
Streptococcus gallolyticus	0%	0%	0%	0%	0%
Streptococcus gordonii	0%	0%	1.28%	0%	0%
Streptococcus gordonii	0%	0%	0%	0%	0%
Streptococcus iniae	0%	0%	2.33%	0%	0%
Streptococcus iniae	0%	0%	0%	0%	0%
Streptococcus intermedius	0%	0%	0%	0%	0%
Streptococcus intermedius	0%	0%	2.27%	0%	0%
Streptococcus mitis	0%	0%	0.51%	0%	0%
Streptococcus mitis	0%	0%	0%	0%	0%
Streptococcus pasteurianus	25%	0%	20%	0%	0%
Streptococcus pasteurianus	0%	0%	0%	0%	0%
Streptococcus pneumoniae	0%	0%	0%	0%	0%
Streptococcus pneumoniae	0%	0%	0.12%	0%	0%
Streptococcus porcinus	50%	0%	33.33%	0%	0%
Streptococcus porcinus	0%	0%	0%	0%	0%
Streptococcus pseudopneumoniae	0%	0%	2.54%	0%	0%
Streptococcus pseudopneumoniae	0%	0%	0%	0%	0%
Streptococcus pyogenes	0%	0%	0%	0%	0%
Streptococcus pyogenes	1.49%	0%	0.77%	0%	0%
Streptococcus sanguinis	0%	0%	2.06%	0%	0%
Streptococcus sanguinis	0%	0%	0%	0%	0%
Streptococcus suis	63.2%	0%	57.82%	0%	0%
Streptococcus suis	0%	0%	0%	0%	0%
Streptococcus uberis	0%	0%	0%	0%	0%
Streptococcus uberis	0%	0%	0.89%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300

Protein
DNA

>gb|AAA23033.2|+|tet(O) [Campylobacter jejuni]
MKIINLGILAHVDAGKTTLTESLLYTSGAIAELGSVDEGTTRTDTMNLERQRGITIQTAVTSFQWEDVKVNIIDTPGHMDFLAEVYRSLS
VLDGAVLLVSAKDGIQAQTRILFHALQIMKIPTIFFINKIDQEGIDLPMVYREMKAKLSSEIIVKQKVGQHPHINVTDNDDMEQWDAVIM
GNDELLEKYMSGKPFKMSELEQEENRRFQNGTLFPVYHGSAKNNLGTRQLIEVIASKFYSSTPEGQSELCGQVFKIEYSEKRRRFVYVRI
YSGTLHLRDVIRISEKEKIKITEMYVPTNGELYSSDTACSGDIVILPNDVLQLNSILGNEILLPQRKFIENPLPMIQTTIAVKKSEQREI
LLGALTEISDCDPLLKYYVDTTTHEIILSFLGNVQMEVICAILEEKYHVEAEIKEPTVIYMERPLRKAEYTIHIEVPPNPFWASVGLSIE
PLPIGSGVQYESRVSLGYLNQSFQNAVMEGVLYGCEQGLYGWKVTDCKICFEYGLYYSPVSTPADFRLLSPIVLEQALKKAGTELLEPYL
HFEIYAPQEYLSRAYHDAPRYCADIVSTQIKNDEVILKGEIPARCIQEYRNDLTYFTNGQGVCLTELKGYQPAIGKFICQPRRPNSRIDK
VRHMFHKLA

>gb|M18896.2|+|207-2126|tet(O) [Campylobacter jejuni]
ATGAAAATAATTAACTTAGGCATTCTGGCTCACGTTGACGCAGGAAAGACAACATTAACGGAAAGTTTATTGTATACCAGTGGTGCAATT
GCAGAACTAGGGAGCGTAGATGAAGGCACAACAAGGACAGATACAATGAATTTGGAGCGTCAAAGGGGAATCACTATCCAGACAGCAGTG
ACATCTTTTCAGTGGGAGGATGTAAAAGTCAACATTATAGATACGCCAGGCCATATGGATTTTTTGGCGGAAGTATACCGTTCTTTATCC
GTATTAGACGGAGCAGTATTATTAGTTTCTGCAAAGGATGGCATACAGGCACAGACCCGTATACTGTTTCATGCACTACAGATAATGAAG
ATTCCGACAATTTTTTTCATCAATAAAATTGACCAAGAGGGGATTGATTTGCCAATGGTATATCGGGAAATGAAAGCAAAGCTTTCTTCG
GAAATTATAGTGAAGCAAAAGGTTGGGCAGCATCCCCATATAAATGTAACGGACAATGACGATATGGAACAGTGGGATGCGGTAATTATG
GGAAACGATGAACTATTAGAGAAATATATGTCAGGGAAACCGTTTAAAATGTCAGAACTGGAACAGGAAGAAAACAGGAGATTCCAAAAC
GGAACGTTATTTCCCGTTTATCACGGAAGCGCTAAAAACAATCTGGGGACTCGGCAGCTTATAGAAGTAATTGCCAGTAAATTTTATTCA
TCAACGCCTGAAGGTCAATCTGAACTATGCGGGCAGGTTTTTAAGATTGAATATTCAGAGAAAAGGCGGCGTTTTGTTTATGTGCGTATA
TATAGCGGAACATTGCATTTGAGGGATGTTATTAGAATATCTGAAAAAGAGAAAATAAAAATCACAGAGATGTATGTTCCGACAAACGGT
GAATTATATTCATCCGATACAGCCTGCTCTGGTGATATTGTAATTTTACCAAATGATGTTTTGCAGCTAAACAGTATTTTGGGGAACGAA
ATACTGTTGCCGCAGAGAAAATTTATTGAAAATCCTCTCCCTATGATCCAAACAACGATTGCAGTAAAGAAATCTGAACAGCGGGAAATA
TTGCTTGGGGCACTTACAGAAATTTCAGATTGCGACCCTCTTTTAAAATATTATGTGGATACTACAACGCATGAGATTATACTTTCTTTT
TTGGGGAATGTGCAGATGGAAGTCATTTGTGCCATCCTTGAGGAAAAATATCATGTGGAGGCAGAAATAAAAGAGCCTACTGTTATATAT
ATGGAAAGACCGCTTAGAAAAGCAGAATATACCATCCACATAGAAGTCCCGCCAAATCCTTTCTGGGCTTCTGTCGGGTTGTCCATAGAG
CCGCTCCCTATTGGAAGCGGAGTGCAGTATGAAAGCAGAGTTTCACTTGGATATTTAAATCAATCGTTCCAAAATGCGGTTATGGAGGGG
GTTCTTTATGGCTGCGAGCAGGGGCTGTATGGATGGAAAGTGACAGACTGTAAAATCTGTTTTGAATATGGATTGTATTATAGTCCTGTA
AGTACCCCCGCAGACTTTCGGCTGCTTTCCCCTATCGTATTGGAGCAGGCTTTAAAAAAAGCAGGGACAGAACTATTAGAGCCATATCTC
CACTTTGAAATTTATGCACCGCAGGAATATCTCTCACGGGCGTATCATGATGCTCCAAGGTATTGTGCAGATATTGTAAGTACTCAGATA
AAGAATGACGAGGTCATTCTGAAAGGAGAAATCCCTGCTAGATGTATTCAAGAATACAGGAACGATTTAACTTATTTCACAAATGGGCAG
GGAGTCTGCTTGACAGAGTTAAAAGGATACCAGCCAGCTATTGGTAAATTTATTTGCCAACCCCGCCGCCCGAATAGCCGTATAGATAAG
GTTCGGCATATGTTCCACAAGTTAGCTTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

tet(O)

Prevalence: protein homolog model (view sequences)

Graph