tetS

Accession ARO:3000192
DefinitionTet(S) is a ribosomal protection protein found in Gram-positive and Gram-negative strains. It is similar to tet(M) and tet(O).
AMR Gene Familytetracycline-resistant ribosomal protection protein
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic target protection
ResistomesEnterococcus faecaliswgs, Enterococcus faeciumg
Classification8 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ tetracycline-resistant ribosomal protection protein [AMR Gene Family]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic doxycycline [Antibiotic]
+ confers_resistance_to_antibiotic minocycline [Antibiotic]
+ confers_resistance_to_antibiotic chlortetracycline [Antibiotic]
+ confers_resistance_to_antibiotic demeclocycline [Antibiotic]
+ confers_resistance_to_antibiotic oxytetracycline [Antibiotic]
Publications

Charpentier E, et al. 1994. Antimicrob Agents Chemother 38(10): 2330-2335. Presence of the Listeria tetracycline resistance gene tet(S) in Enterococcus faecalis. (PMID 7840565)

Charpentier E, et al. 1993. Gene 131(1): 27-34. Characterization of a new class of tetracycline-resistance gene tet(S) in Listeria monocytogenes BM4210. (PMID 8370538)

Resistomes

Prevalence of tetS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis0%0%2.97%
Enterococcus faecium0.8%0.35%1.63%
Staphylococcus aureus0%0%0.03%
Streptococcus pneumoniae0%0%0.01%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1200


>gb|AAA25293.1|+|tetS [Listeria monocytogenes]
MKIINIGILAHVDAGKTTLTESLLYSSGAIKELGSVDSGTTKTDTMFLERQRGITIQTAITSFQRENVKVNIVDTPGHMDFLADVYRSLS
VLDGAILLISAKDGVQSQTRILFHALRKMNIPIIFFINKIDQNGINLPDVYQDIKDKLSDDIIIKQTVNLNLKPYVIDYTEPEQWETVIV
GNDYLLEKYTIGKTLNIAELEKEENERIQSCSLYPVYHGSAKNNIGIKQLIEVITSKLFSPTQLNSDKLCGNVFKVEYSDDGQRLVYVRL
YSGTLHLRDSVNISEKEKIKVTEMYTSINGELRQIDKAEPGEIIILKNELLKLNNVLGDKKRLPHREILENPLPMLQTTIEPCKSVQREK
LLDALFEISDSDPLLQYYVDTVTHEIVLSFLGEVQMEVTCTLIQEKYHIEIETRKPTVIYMERPLKKSEFTIDIEVPPNPFWASIGLSVT
PLPLGSGIQYESLVSLGYLNQSFQNAVMEGIRYGCEQGLYGWKLTDCKICFKYGLYYSPVSTPADFRMLAPIVLEQAFRKSGTELLEPYL
SFEIYVPQEYLSRAYNDASKYCANILNTKLKGNEVILIGEIPARCIQEYRNSLTFFTNGRSVCLTELKGYQVTNIKSAFQPRRPNNRIDK
VRHMFNKINLH


>gb|L09756|+|1-1926|tetS [Listeria monocytogenes]
TTGAAAATTATTAATATCGGTATCTTAGCACATGTTGATGCAGGAAAAACTACTTTGACAGAAAGCTTACTATACAGTAGCGGAGCAATT
AAAGAGTTAGGAAGTGTAGATAGCGGTACAACGAAAACGGATACTATGTTTTTGGAACGCCAGAGAGGTATTACTATTCAGACCGCAATA
ACATCTTTTCAACGGGAAAATGTTAAAGTAAATATTGTAGATACTCCTGGACACATGGATTTTTTGGCAGATGTATACCGTTCATTATCT
GTTTTGGATGGAGCTATTTTGCTAATCTCTGCAAAAGATGGAGTACAGTCACAAACTCGTATACTATTCCATGCACTTAGAAAGATGAAC
ATACCTATAATATTTTTTATTAACAAAATTGATCAAAATGGAATAAATTTGCCAGATGTTTATCAAGATATTAAGGACAAACTTTCTGAC
GACATCATAATTAAGCAGACTGTGAATCTAAATTTGAAACCTTATGTAATAGATTATACTGAACCAGAACAATGGGAGACAGTAATTGTG
GGAAATGATTATTTATTAGAAAAATATACCATTGGGAAAACATTGAATATTGCAGAACTTGAAAAGGAGGAAAACGAAAGAATTCAAAGT
TGCTCCTTATATCCTGTTTATCACGGAAGTGCAAAGAATAATATTGGAATTAAACAACTTATAGAGGTAATTACTAGCAAATTATTTTCA
CCCACACAACTCAATTCAGATAAACTTTGTGGAAATGTTTTTAAAGTAGAATATTCAGATGATGGTCAACGGCTTGTCTATGTACGTCTT
TATAGTGGAACGCTACATTTGCGAGACTCAGTCAATATATCAGAAAAGGAAAAAATAAAAGTTACAGAAATGTATACTTCAATAAATGGA
GAATTACGCCAGATAGATAAGGCAGAGCCTGGTGAGATTATTATTTTAAAAAATGAGCTTTTAAAACTAAATAACGTACTTGGAGATAAA
AAAAGATTACCACATAGAGAAATTCTTGAGAATCCTCTTCCTATGTTACAAACAACAATTGAACCATGTAAATCAGTACAAAGAGAAAAG
TTACTAGATGCACTTTTTGAAATATCCGATAGTGATCCCCTTCTACAATATTATGTAGATACAGTAACTCACGAAATTGTGCTATCTTTT
TTAGGTGAGGTCCAAATGGAGGTAACTTGTACTCTGATTCAAGAAAAATATCATATTGAGATAGAAACAAGAAAACCAACTGTCATTTAT
ATGGAAAGACCATTAAAAAAATCTGAATTTACCATTGATATCGAAGTACCTCCAAATCCTTTCTGGGCTTCTATTGGTTTATCTGTAACA
CCACTTCCTTTGGGTAGTGGCATTCAGTATGAGAGCCTGGTTTCTCTAGGTTATTTAAATCAATCATTTCAAAATGCAGTTATGGAAGGT
ATACGCTATGGGTGTGAACAAGGATTGTACGGTTGGAAATTAACAGACTGTAAGATCTGTTTTAAGTATGGTCTATATTACAGCCCTGTC
AGTACGCCAGCAGATTTCCGAATGCTTGCGCCTATTGTACTAGAGCAGGCTTTTAGAAAGAGTGGTACAGAGTTATTAGAGCCATATCTT
AGCTTCGAAATTTATGTACCACAAGAATATCTTTCGAGAGCATATAATGATGCTTCCAAATATTGTGCAAATATTTTAAATACTAAGTTA
AAAGGTAACGAGGTCATTCTCATTGGTGAAATTCCAGCCCGTTGTATTCAAGAGTATCGAAACAGTTTAACTTTCTTTACAAATGGACGC
AGTGTCTGTTTAACAGAGTTAAAAGGTTATCAGGTTACTAACATTAAGTCTGCTTTCCAACCACGTCGTCCAAATAATAGAATAGACAAA
GTAAGGCATATGTTTAATAAAATCAACTTACATTGA