tetT

Accession ARO:3000193
DefinitionTet(T) is a ribosomal protection protein of streptococci. It is similar to Tet(Q).
AMR Gene Familytetracycline-resistant ribosomal protection protein
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic target protection
Classification8 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ tetracycline-resistant ribosomal protection protein [AMR Gene Family]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic doxycycline [Antibiotic]
+ confers_resistance_to_antibiotic minocycline [Antibiotic]
+ confers_resistance_to_antibiotic chlortetracycline [Antibiotic]
+ confers_resistance_to_antibiotic demeclocycline [Antibiotic]
+ confers_resistance_to_antibiotic oxytetracycline [Antibiotic]
Publications

Clermont D, et al. 1997. Antimicrob Agents Chemother 41(1): 112-116. New tetracycline resistance determinants coding for ribosomal protection in streptococci and nucleotide sequence of tet(T) isolated from Streptococcus pyogenes A498. (PMID 8980765)

Resistomes

Prevalence of tetT among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Staphylococcus aureus0%0.08%0.03%
Stenotrophomonas maltophilia0%0%0.33%
Streptococcus pyogenes0%0%0.32%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1200


>gb|AAF01499.1|+|tetT [Streptococcus pyogenes]
MKIINIGILAHVDAGKTTVTEGLLYKSGAINKIGRVDNATTTTDSMELERDRGITIRASTVSFNYNDTKVNIIDTPGHMDFIAEVERTLK
VLDGAILVISAKEGIQVQTKVIFNTLVKLNIPTLIFVNKIDRKGVCLDEIYTQIQEKLTSNLAIMQSVKIKDKGDFELTNVRDDKVIQSQ
IIEKLLDINDYLAEKYINGDVIAEKEYNDVFLDEINNCNLYPVFHGSALKNIGIDELLFAITKYLPTKSYNTEDLLSAYVYKIDRDEKSR
KMTFLRVFSGNIRTRQDVYINGTEETFKIKSLESIMNGEIVKVGQVNSGDIAIISNANSLKIGDYIGKKYDGILDIKIAQPALRASIKPC
DLSKRSKLIEALFELTEEDPFLDCEINGDTGEIILRLFGNIQMEVIESLLKSRYKIDARFGELKTIYKERPKRNSKAVIHIEVPPNPYWA
SIGLSIEPLPIGSGLLYKTEVSYGYLNNSFQNAVKDAVEKACKEGLYGWEVTDLKVTFDYGLYYSPVSTPSDFRNLTPYVFWEALRKAGT
EILEPYLKYTVQVPNDFCGRVMSDLRKMRASIEDIIAKGEETTLSGKIPVDTSKSYQSELLSYSNGKGIFITEPYGYDIYNDKPIINDIG
NDNNDSNKEGLRYLFQKQDEN


>gb|L42544|+|1-1956|tetT [Streptococcus pyogenes]
ATGAAAATTATTAATATAGGAATATTAGCACATGTTGATGCAGGTAAAACAACTGTTACAGAAGGTTTATTATATAAAAGTGGGGCGATT
AATAAAATTGGAAGAGTTGATAATGCTACAACGACAACGGATTCGATGGAACTTGAAAGAGATAGGGGAATAACTATACGGGCGTCTACA
GTTTCATTTAATTACAATGATACAAAGGTAAATATCATAGATACACCTGGGCACATGGATTTCATAGCCGAAGTTGAGCGAACTCTGAAA
GTGTTAGATGGAGCTATTTTAGTAATTTCAGCAAAAGAAGGAATTCAAGTCCAAACTAAAGTGATTTTTAATACTTTAGTGAAATTAAAT
ATACCAACACTTATATTTGTGAATAAAATAGATCGAAAGGGAGTATGTTTGGATGAGATATACACTCAAATACAGGAGAAATTAACTTCT
AATCTTGCAATAATGCAATCAGTTAAAATAAAAGATAAAGGTGATTTTGAATTGACAAATGTAAGGGATGATAAAGTAATTCAAAGTCAA
ATAATAGAGAAGTTACTGGATATAAATGATTATCTAGCAGAAAAATATATAAATGGCGATGTCATTGCAGAAAAAGAATATAATGATGTA
TTTTTGGATGAGATTAATAACTGCAATCTTTATCCTGTATTTCATGGTTCGGCTTTAAAAAATATTGGAATTGACGAGCTATTATTTGCC
ATTACTAAATATCTTCCTACCAAGAGCTATAATACTGAAGACCTTTTATCAGCGTATGTTTATAAGATTGATAGGGATGAAAAATCTAGA
AAGATGACTTTCTTAAGAGTATTCAGTGGGAATATAAGGACACGTCAAGATGTTTATATAAATGGCACAGAAGAAACTTTCAAGATAAAA
AGTCTGGAATCAATTATGAATGGTGAAATTGTGAAGGTAGGTCAGGTTAATAGTGGGGATATTGCTATTATTTCTAATGCTAATTCTCTG
AAGATAGGTGATTATATTGGTAAGAAATATGACGGGATTTTAGATATAAAGATAGCCCAACCGGCATTGAGAGCATCAATTAAACCTTGT
GATTTAAGCAAAAGAAGCAAACTGATAGAAGCACTATTTGAATTAACTGAAGAAGACCCATTTCTCGATTGTGAAATTAACGGAGATACT
GGAGAAATCATATTGAGGCTATTTGGAAATATTCAAATGGAAGTAATAGAATCACTACTTAAAAGCCGATACAAAATAGATGCTAGATTT
GGTGAATTGAAAACAATATATAAAGAACGACCTAAGAGAAACTCTAAAGCAGTAATCCATATAGAGGTTCCACCAAATCCTTATTGGGCA
TCTATTGGACTGTCAATAGAACCACTACCAATAGGGTCAGGATTATTATATAAGACAGAGGTGTCCTATGGATATTTAAATAATTCATTT
CAAAATGCAGTAAAAGATGCTGTAGAGAAGGCTTGTAAAGAAGGGCTTTATGGATGGGAAGTTACAGACTTAAAGGTAACTTTTGACTAC
GGATTATACTATAGCCCGGTAAGTACCCCCTCTGACTTTAGGAATTTAACACCATATGTATTTTGGGAAGCTCTTCGAAAAGCAGGAACT
GAAATATTAGAACCTTATTTAAAATATACAGTTCAAGTTCCAAATGATTTCTGCGGAAGGGTTATGAGTGATCTTAGAAAGATGAGGGCT
TCTATTGAAGATATAATAGCCAAGGGAGAGGAGACAACTTTAAGTGGAAAGATACCTGTTGATACATCGAAGTCCTATCAGTCAGAATTA
CTTTCTTATTCAAATGGAAAGGGTATATTTATTACTGAGCCTTATGGGTATGATATATATAATGATAAGCCTATAATTAATGATATTGGG
AACGACAATAATGATAGCAACAAGGAAGGGTTAAGATATTTATTTCAAAAACAGGATGAAAATTGA