tet32

Accession ARO:3000196
DefinitionTet32 is a tetracycline resistance gene similar to Tet(O), and binds to the ribosome to confer tetracycline resistance as a ribosomal protection protein.
AMR Gene Familytetracycline-resistant ribosomal protection protein
Drug Classtetracycline antibiotic
Resistance Mechanismantibiotic target protection
ResistomesStreptococcus anginosusg+wgs
Classification8 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ tetracycline-resistant ribosomal protection protein [AMR Gene Family]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic doxycycline [Antibiotic]
+ confers_resistance_to_antibiotic minocycline [Antibiotic]
+ confers_resistance_to_antibiotic chlortetracycline [Antibiotic]
+ confers_resistance_to_antibiotic demeclocycline [Antibiotic]
+ confers_resistance_to_antibiotic oxytetracycline [Antibiotic]
Publications

Warburton P, et al. 2008. Antimicrob Agents Chemother 53(1): 273-276. Characterization of tet(32) genes from the oral metagenome. (PMID 18955517)

Melville CM, et al. 2001. Antimicrob Agents Chemother 45(11): 3246-3249. Novel tetracycline resistance gene, tet(32), in the Clostridium-related human colonic anaerobe K10 and its transmission in vitro to the rumen anaerobe Butyrivibrio fibrisolvens. (PMID 11600392)

Resistomes

Prevalence of tet32 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Streptococcus anginosus14.29%0%5.13%
Streptococcus constellatus66.67%0%0%
Streptococcus pneumoniae0%0%0.01%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1200


>gb|ACH87088.1|+|tet32 [Escherichia coli]
MKIINIGILAHVDAGKTTLTESLLYTSGAIAEQGNVDKGTTRTDTMILERQRGITIQTAVTSFYWNDYKINIVDTPGHMDFLTEAYRSLS
VLDGAVLVISAKDGVQAQTRILFHALQKMDIPTIIFINKIDQNGIDLQCVYQSIKDKLTSDMIVMQEVSLSPKITMTDISDLDKWDMIIS
GSDELLERYVAEDSLDIQELQYEKCKRTRCCSLFPVYHGSAKDNLGTEKLIEAIIETFITETDDIQSELCGYVFKVEYTERKKRLSYLRL
YHGTLHLRDTLLLSKKEKIKITEMCIPSNGEIVPADHACPGEIVILADDTLKLNDILGNEKLLPHKTRIDNPMPLLRTTVEPQKPEQREA
LLNALAEIADTDPLLHFDIDTVTHEIMLSFLGKVQLEVICSLLEEKYHVGVAMKEPSVIYLERPQKKASCTIHIEVPPNPFWASIGLTVT
PLPVGSGTQYKSEVSLGYLNQSFQNAVMEGVRYGMEQGLYGWGVTDCQICFDYGVYYSPVSTPADFRFLAPVVLEQALKKAGTQLLEPYL
SFTLFAPQEYLSRAYNDAPKYCAIIESTRLEKDEVIFKGEIPARCIGEYRNDLNFYTNGRSVCITELKGYQETSGEPVFQPRRPNSRLDK
IRHMFQKIM


>gb|EU722333.1|+|1933-3852|tet32 [Escherichia coli]
ATGAAAATAATCAATATCGGCATTCTGGCCCATGTAGACGCAGGAAAAACTACATTGACAGAAAGTCTGCTATACACCAGTGGAGCGATT
GCGGAACAGGGAAACGTGGATAAAGGGACCACAAGAACAGACACTATGATTTTGGAACGGCAACGGGGAATTACCATTCAGACAGCGGTT
ACTTCTTTTTATTGGAATGATTATAAAATCAATATCGTGGACACTCCCGGTCATATGGATTTTTTAACCGAAGCATACCGCTCTTTATCT
GTCCTTGACGGAGCTGTTTTAGTCATTTCAGCAAAAGACGGCGTACAGGCACAAACCCGTATATTATTCCATGCGCTTCAGAAAATGGAC
ATTCCGACAATTATCTTTATAAATAAGATAGACCAAAATGGGATCGACCTGCAGTGTGTTTACCAAAGCATTAAAGATAAACTTACCAGT
GATATGATTGTCATGCAGGAGGTTTCCCTGTCGCCAAAGATAACCATGACCGATATTTCTGATTTAGACAAATGGGATATGATTATTTCC
GGAAGCGATGAACTATTAGAACGATATGTTGCAGAGGATTCTTTGGATATACAGGAATTACAATATGAAAAGTGCAAAAGAACCAGATGC
TGCTCTTTGTTTCCTGTTTATCATGGGAGTGCAAAAGACAATTTAGGAACAGAAAAACTGATTGAAGCGATTATAGAAACTTTCATTACA
GAAACGGACGATATTCAGTCTGAATTATGTGGATATGTTTTTAAGGTTGAGTATACAGAGCGGAAAAAACGGCTTTCTTATTTACGCCTG
TATCATGGGACGCTCCATTTACGGGATACCCTGCTGCTGTCAAAAAAGGAAAAAATAAAGATTACAGAAATGTGTATTCCGTCAAATGGT
GAAATCGTCCCGGCTGACCATGCCTGTCCGGGAGAAATTGTTATTTTAGCTGATGATACTTTGAAACTGAACGATATCCTGGGAAATGAA
AAACTCCTGCCTCACAAAACACGGATTGATAATCCCATGCCATTACTTCGGACAACGGTAGAGCCGCAAAAGCCGGAGCAAAGGGAAGCC
CTGTTAAATGCCCTCGCAGAGATTGCTGATACAGACCCTCTTTTGCATTTTGACATTGATACTGTTACCCATGAGATTATGTTATCTTTT
TTGGGAAAAGTACAGTTAGAAGTTATTTGTTCGCTATTAGAAGAAAAATATCATGTGGGCGTGGCTATGAAAGAGCCTTCGGTTATTTAT
CTGGAAAGACCGCAAAAAAAAGCGAGCTGCACGATTCATATTGAAGTGCCGCCGAATCCGTTTTGGGCATCTATTGGTTTGACTGTAACA
CCGCTTCCTGTTGGAAGCGGAACACAATATAAAAGCGAGGTATCTCTCGGCTATTTAAACCAAAGTTTTCAAAATGCCGTCATGGAGGGT
GTGCGTTATGGAATGGAGCAGGGCTTATATGGCTGGGGAGTGACAGACTGCCAAATTTGTTTTGATTATGGAGTTTATTACAGCCCGGTC
AGCACCCCCGCTGATTTTCGTTTTCTTGCGCCTGTCGTGTTGGAGCAGGCATTGAAAAAAGCAGGGACACAACTGTTGGAACCATACCTT
TCCTTTACCCTTTTTGCACCGCAGGAATATCTTTCACGGGCTTATAATGATGCACCAAAGTATTGCGCAATCATTGAATCAACCAGACTT
GAAAAAGATGAAGTTATTTTTAAGGGTGAAATCCCTGCCCGTTGTATCGGTGAATATAGGAATGATCTGAATTTTTATACAAATGGAAGA
AGTGTCTGCATTACAGAATTAAAAGGGTATCAGGAAACTTCCGGCGAGCCTGTATTTCAGCCACGCCGCCCGAACAGCCGTTTAGACAAG
ATCCGGCATATGTTTCAGAAGATAATGTAA