sul1

Accession ARO:3000410
CARD Short Namesul1
DefinitionSul1 is a sulfonamide resistant dihydropteroate synthase of Gram-negative bacteria. It is linked to other resistance genes of class 1 integrons.
AMR Gene Familysulfonamide resistant sul
Drug Classsulfonamide antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAchromobacter xylosoxidansg+p+wgs, Acinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter haemolyticusp, Acinetobacter indicusg+p+wgs, Acinetobacter johnsoniip+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiip+wgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiip+wgs, Acinetobacter townerig+wgs, Acinetobacter wuhouensisp+wgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+p+wgs, Alcaligenes faecalisg+p+wgs, Bordetella bronchisepticawgs, Bordetella trematumg, Burkholderia ambifariawgs, Burkholderia cenocepaciag+wgs, Burkholderia vietnamiensiswgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+p+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaewgs, Comamonas testosteronig+p, Corynebacterium diphtheriaeg+wgs, Corynebacterium urealyticumwgs, Cronobacter malonaticuswgs, Cronobacter sakazakiip, Edwardsiella tardag+wgs, Enterobacter asburiaeg+p+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeig+p+wgs, Enterobacter roggenkampiip+wgs, Escherichia albertiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesg+p+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensisg+wgs, Leclercia adecarboxylatag+p+wgs, Morganella morganiig+p+wgs, Mycolicibacterium fortuitumwgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp, Providencia alcalifaciensg, Providencia heimbachaep, Providencia rettgerig+p+wgs, Providencia stuartiig+p+wgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas chlororaphiswgs, Pseudomonas koreensiswgs, Pseudomonas mendocinawgs, Pseudomonas monteiliig+p+wgs, Pseudomonas putidag+p+wgs, Pseudomonas stutzerig+p+wgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensg+p+wgs, Shewanella putrefaciensg+p+wgs, Shigella boydiiwgs, Shigella dysenteriaep+wgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Staphylococcus haemolyticuswgs, Stenotrophomonas maltophiliag+wgs, Vibrio alginolyticusp+wgs, Vibrio choleraeg+p+wgs, Vibrio fluvialiswgs, Vibrio parahaemolyticusp+wgs, Vibrio vulnificuswgs
Resistomes with Sequence VariantsAchromobacter xylosoxidansg+p+wgs, Acinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter haemolyticusp, Acinetobacter indicusg+p+wgs, Acinetobacter johnsoniip+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiip+wgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiip+wgs, Acinetobacter radioresistenswgs, Acinetobacter townerig+wgs, Acinetobacter wuhouensisp+wgs, Aeromonas caviaeg+p+wgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniig+p+wgs, Alcaligenes faecalisg+p+wgs, Bordetella bronchisepticawgs, Bordetella trematumg, Burkholderia ambifariawgs, Burkholderia cenocepaciag+wgs, Burkholderia cepaciawgs, Burkholderia vietnamiensiswgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+p+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaewgs, Comamonas testosteronig+p+wgs, Corynebacterium diphtheriaeg+wgs, Corynebacterium urealyticumwgs, Cronobacter malonaticuswgs, Cronobacter sakazakiip, Delftia tsuruhatensisg, Edwardsiella tardag+wgs, Enterobacter asburiaeg+p+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeig+p+wgs, Enterobacter roggenkampiip+wgs, Erysipelatoclostridium ramosumwgs, Escherichia albertiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesg+p+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocag+p+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensisg+wgs, Leclercia adecarboxylatag+p+wgs, Micrococcus luteusg+wgs, Morganella morganiig+p+wgs, Mycobacterium colombiensewgs, Mycobacterium tuberculosiswgs, Mycolicibacterium fortuitumwgs, Nocardia farcinicap, Proteus mirabilisg+p+wgs, Proteus vulgarisp+wgs, Providencia alcalifaciensg, Providencia heimbachaep, Providencia rettgerig+p+wgs, Providencia stuartiig+p+wgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas chlororaphiswgs, Pseudomonas koreensiswgs, Pseudomonas mendocinawgs, Pseudomonas monteiliig+p+wgs, Pseudomonas putidag+p+wgs, Pseudomonas stutzerig+p+wgs, Raoultella planticolap+wgs, Rhodococcus pyridinivoransg, Salmonella entericag+p+wgs, Serratia marcescensg+p+wgs, Shewanella putrefaciensg+p+wgs, Shigella boydiiwgs, Shigella dysenteriaep+wgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Sphingobium yanoikuyaep+wgs, Staphylococcus aureuswgs, Staphylococcus haemolyticuswgs, Stenotrophomonas maltophiliag+wgs, Streptococcus suiswgs, Trueperella pyogenesg+wgs, Vibrio alginolyticusp+wgs, Vibrio choleraeg+p+wgs, Vibrio fluvialiswgs, Vibrio harveyiwgs, Vibrio parahaemolyticusp+wgs, Vibrio vulnificuswgs
Classification7 ontology terms | Show
Parent Term(s)11 ontology terms | Show
+ derives_from antibiotic sensitive dihydropteroate synthase
+ confers_resistance_to_antibiotic sulfadiazine [Antibiotic]
+ confers_resistance_to_antibiotic sulfadimidine [Antibiotic]
+ confers_resistance_to_antibiotic sulfadoxine [Antibiotic]
+ confers_resistance_to_antibiotic sulfamethoxazole [Antibiotic]
+ confers_resistance_to_antibiotic sulfisoxazole [Antibiotic]
+ confers_resistance_to_antibiotic sulfacetamide [Antibiotic]
+ confers_resistance_to_antibiotic mafenide [Antibiotic]
+ confers_resistance_to_antibiotic sulfasalazine [Antibiotic]
+ confers_resistance_to_antibiotic sulfamethizole [Antibiotic]
+ sulfonamide resistant sul [AMR Gene Family]
Publications

Skold O. 2001. Vet Res 32(3-4): 261-273. Resistance to trimethoprim and sulfonamides. (PMID 11432417)

Krizova L, et al. 2011. Antimicrob. Agents Chemother. 55(7):3201-6 Diversity and evolution of AbaR genomic resistance islands in Acinetobacter baumannii strains of European clone I. (PMID 21537009)

Chen YT, et al. 2009. Antimicrob. Agents Chemother. 53(3):1235-7 Mobilization of qnrB2 and ISCR1 in plasmids. (PMID 19075060)

Márquez C, et al. 2008. J. Clin. Microbiol. 46(10):3417-25 Urinary tract infections in a South American population: dynamic spread of class 1 integrons and multidrug resistance by homologous and site-specific recombination. (PMID 18753343)

Doi Y, et al. 2007. Antimicrob. Agents Chemother. 51(3):852-6 Coproduction of novel 16S rRNA methylase RmtD and metallo-beta-lactamase SPM-1 in a panresistant Pseudomonas aeruginosa isolate from Brazil. (PMID 17158944)

Martínez N, et al. 2007. J. Antimicrob. Chemother. 60(6):1227-34 Detailed structure of integrons and transposons carried by large conjugative plasmids responsible for multidrug resistance in diverse genomic types of Salmonella enterica serovar Brandenburg. (PMID 17827139)

Resistomes

Prevalence of sul1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Achromobacter xylosoxidans9.09%14.29%6.5%0%
Acinetobacter baumannii44.06%2.11%32.36%0%
Acinetobacter defluvii0%12.5%0%0%
Acinetobacter haemolyticus0%2.44%0%0%
Acinetobacter indicus9.52%5.66%1.39%0%
Acinetobacter johnsonii0%2.78%8%0%
Acinetobacter junii0%33.33%3.57%0%
Acinetobacter lwoffii0%1.49%4.35%0%
Acinetobacter nosocomialis0%0%4.55%0%
Acinetobacter pittii0%4.21%5.26%0%
Acinetobacter radioresistens0%0%2.44%0%
Acinetobacter towneri25%0%10.53%0%
Acinetobacter wuhouensis0%4.55%50%0%
Aeromonas caviae54.84%18.37%66.21%0%
Aeromonas hydrophila16%8.89%10%0%
Aeromonas veronii19.35%11.63%8.33%0%
Alcaligenes faecalis12.5%50%26.92%0%
Bordetella bronchiseptica0%0%2.7%0%
Bordetella trematum20%0%0%0%
Burkholderia ambifaria0%0%1.3%0%
Burkholderia cenocepacia0.5%0%8.42%0%
Burkholderia cepacia0%0%6.76%0%
Burkholderia vietnamiensis0%0%1.72%0%
Citrobacter amalonaticus0%18.18%12.5%0%
Citrobacter freundii7.14%13.14%29.76%0%
Citrobacter koseri6.67%12.5%8.33%0%
Citrobacter portucalensis0%24.24%43.1%0%
Citrobacter werkmanii0%10%48.72%0%
Citrobacter youngae0%0%37.5%0%
Comamonas testosteroni25%50%6.67%0%
Corynebacterium diphtheriae21.05%0%18.79%0%
Corynebacterium urealyticum0%0%20%0%
Cronobacter malonaticus0%0%1.82%0%
Cronobacter sakazakii0%3.12%0%0%
Delftia tsuruhatensis33.33%0%0%0%
Edwardsiella tarda11.11%0%13.33%0%
Enterobacter asburiae7.69%7.27%20.89%0%
Enterobacter chengduensis0%0%47.62%0%
Enterobacter cloacae5.77%13.12%23.74%0%
Enterobacter hormaechei3.4%27.21%35.58%0%
Enterobacter kobei5.56%13.58%22.68%0%
Enterobacter roggenkampii0%3.83%12.15%0%
Erysipelatoclostridium ramosum0%0%1.28%0%
Escherichia albertii4.55%5.13%4.3%0%
Escherichia coli3.69%4.83%17.27%0%
Escherichia fergusonii0%3.38%8.45%0%
Klebsiella aerogenes4.65%15.38%5.86%0%
Klebsiella huaxiensis100%0%0%0%
Klebsiella michiganensis11.54%23.7%14.03%0%
Klebsiella oxytoca6.06%9.02%15.69%0%
Klebsiella pneumoniae17.15%10.59%34.98%0%
Klebsiella quasipneumoniae0%11.05%35.36%0%
Laribacter hongkongensis66.67%0%6.25%0%
Leclercia adecarboxylata7.69%11.11%20%0%
Micrococcus luteus6.25%0%2.2%0%
Morganella morganii36%10.81%21.38%0%
Mycobacterium colombiense0%0%5%0%
Mycobacterium tuberculosis0%0%0.03%0%
Mycolicibacterium fortuitum0%0%3.85%0%
Nocardia farcinica0%8.33%0%0%
Proteus mirabilis63.74%28.36%22.61%0%
Proteus vulgaris0%37.5%13.33%0%
Providencia alcalifaciens18.18%0%0%0%
Providencia heimbachae0%100%0%0%
Providencia rettgeri25%19.44%33.09%0%
Providencia stuartii15.38%17.86%22.73%0%
Pseudomonas aeruginosa24.39%11.22%16.86%0%
Pseudomonas chlororaphis0%0%2.33%0%
Pseudomonas koreensis0%0%5.26%0%
Pseudomonas mendocina0%0%15.38%0%
Pseudomonas monteilii22.22%14.29%25%0%
Pseudomonas putida14%19.05%8.9%0%
Pseudomonas stutzeri6.45%6.25%17.31%0%
Raoultella planticola0%17.14%19.44%0%
Rhodococcus pyridinivorans10%0%0%0%
Salmonella enterica7.14%11.67%16.24%0%
Serratia marcescens1.65%11.26%7.72%0%
Shewanella putrefaciens8.33%55.56%9.09%0%
Shigella boydii0%0%15.38%0%
Shigella dysenteriae0%10%18.52%0%
Shigella flexneri9.68%6.86%11.32%0%
Shigella sonnei0%5%9.7%0%
Sphingobium yanoikuyae0%7.69%10%0%
Staphylococcus aureus0%0%0.01%0%
Staphylococcus haemolyticus0%0%0.44%0%
Stenotrophomonas maltophilia1.37%0%3.61%0%
Streptococcus suis0%0%0.11%0%
Trueperella pyogenes9.09%0%20%0%
Vibrio alginolyticus0%3.57%2%0%
Vibrio cholerae1.44%23.53%6.36%0%
Vibrio fluvialis0%0%4.11%0%
Vibrio harveyi0%0%2%0%
Vibrio parahaemolyticus0%0.67%0.31%0%
Vibrio vulnificus0%0%0.81%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AEJ33969.1|+|sul1 [Vibrio fluvialis]
MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQR
YALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFL
SPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRD
ARDRGLDHA


>gb|JF969163.1|+|1054-1893|sul1 [Vibrio fluvialis]
ATGGTGACGGTGTTCGGCATTCTGAATCTCACCGAGGACTCCTTCTTCGATGAGAGCCGGCGGCTAGACCCCGCCGGCGCTGTCACCGCG
GCGATCGAAATGCTGCGAGTCGGATCAGACGTCGTGGATGTCGGACCGGCCGCCAGCCATCCGGACGCGAGGCCTGTATCGCCGGCCGAT
GAGATCAGACGTATTGCGCCGCTCTTAGACGCCCTGTCCGATCAGATGCACCGTGTTTCAATCGACAGCTTCCAACCGGAAACCCAGCGC
TATGCGCTCAAGCGCGGCGTGGGCTACCTGAACGATATCCAAGGATTTCCTGACCCTGCGCTCTATCCCGATATTGCTGAGGCGGACTGC
AGGCTGGTGGTTATGCACTCAGCGCAGCGGGATGGCATCGCCACCCGCACCGGTCACCTTCGACCCGAAGACGCGCTCGACGAGATTGTG
CGGTTCTTCGAGGCGCGGGTTTCCGCCTTGCGACGGAGCGGGGTCGCTGCCGACCGGCTCATCCTCGATCCGGGGATGGGATTTTTCTTG
AGCCCCGCACCGGAAACATCGCTGCACGTGCTGTCGAACCTTCAAAAGCTGAAGTCGGCGTTGGGGCTTCCGCTATTGGTCTCGGTGTCG
CGGAAATCCTTCTTGGGCGCCACCGTTGGCCTTCCTGTAAAGGATCTGGGTCCAGCGAGCCTTGCGGCGGAACTTCACGCGATCGGCAAT
GGCGCTGACTACGTCCGCACCCACGCGCCTGGAGATCTGCGAAGCGCAATCACCTTCTCGGAAACCCTCGCGAAATTTCGCAGTCGCGAC
GCCAGAGACCGAGGGTTAGATCATGCCTAG