sul2

Accession ARO:3000412
CARD Short Namesul2
DefinitionSul2 is a sulfonamide resistant dihydropteroate synthase of Gram-negative bacteria, usually found on small plasmids.
AMR Gene Familysulfonamide resistant sul
Drug Classsulfonamide antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAchromobacter xylosoxidansg+wgs, Acinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter haemolyticusp, Acinetobacter indicusg+p+wgs, Acinetobacter johnsoniig+p+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialisp+wgs, Acinetobacter pittiip+wgs, Acinetobacter radioresistenswgs, Acinetobacter townerig+p+wgs, Acinetobacter wuhouensisp+wgs, Actinobacillus indolicusg+wgs, Actinobacillus pleuropneumoniaeg+p+wgs, Aeromonas caviaeg+wgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniip, Alcaligenes faecalisg+wgs, Avibacterium paragallinarumg+wgs, Bacteroides fragiliswgs, Bacteroides ovatuswgs, Bacteroides thetaiotaomicronwgs, Bordetella bronchisepticag+wgs, Bordetella trematumg, Burkholderia contaminanswgs, Chryseobacterium taklimakanenseg, Citrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+p, Citrobacter portucalensisg+p+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaewgs, Comamonas testosteroniwgs, Cronobacter dublinensiswgs, Cronobacter sakazakiip, Elizabethkingia anophelisg+wgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia albertiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Glaesserella parasuisg+wgs, Haemophilus parainfluenzaewgs, Histophilus somniwgs, Klebsiella aerogenesg+p+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatawgs, Morganella morganiig+wgs, Myroides odoratimimusg+wgs, Neisseria meningitidiswgs, Parabacteroides distasoniswgs, Pasteurella multocidag+p+wgs, Phocaeicola doreiwgs, Phocaeicola vulgatuswgs, Proteus mirabilisg+p+wgs, Proteus penneriwgs, Proteus vulgarisp+wgs, Providencia alcalifaciensg+wgs, Providencia rettgerig+wgs, Providencia stuartiig+p+wgs, Pseudomonas aeruginosag+wgs, Pseudomonas putidag, Ralstonia pickettiiwgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shewanella putrefaciensg+p+wgs, Shigella boydiip+wgs, Shigella dysenteriaewgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Stenotrophomonas maltophiliag+wgs, Streptococcus suiswgs, Vibrio alginolyticusg+p+wgs, Vibrio choleraeg+p+wgs, Vibrio fluvialiswgs, Vibrio harveyip+wgs, Vibrio neocaledonicusg, Vibrio owensiig, Vibrio parahaemolyticusg+p+wgs, Vibrio vulnificuswgs
Resistomes with Sequence VariantsAchromobacter xylosoxidansg+wgs, Acinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter haemolyticusp, Acinetobacter indicusg+p+wgs, Acinetobacter johnsoniig+p+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialisp+wgs, Acinetobacter pittiip+wgs, Acinetobacter radioresistenswgs, Acinetobacter townerig+p+wgs, Acinetobacter wuhouensisp+wgs, Actinobacillus indolicusg+wgs, Actinobacillus pleuropneumoniaeg+p+wgs, Aeromonas caviaeg+wgs, Aeromonas hydrophilag+p+wgs, Aeromonas veroniip, Alcaligenes faecalisg+wgs, Avibacterium paragallinarumg+wgs, Bacillus anthracisp, Bacteroides fragiliswgs, Bacteroides ovatuswgs, Bacteroides thetaiotaomicrong+wgs, Bordetella bronchisepticag+wgs, Bordetella trematumg, Burkholderia contaminanswgs, Chryseobacterium taklimakanenseg, Citrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Citrobacter koserig+p, Citrobacter portucalensisg+p+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaewgs, Comamonas testosteroniwgs, Cronobacter dublinensiswgs, Cronobacter sakazakiip, Elizabethkingia anophelisg+wgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia albertiig+p+wgs, Escherichia colig+p+wgs, Escherichia fergusoniig+p+wgs, Escherichia marmotaep, Glaesserella parasuisg+wgs, Haemophilus influenzaeg, Haemophilus parainfluenzaeg+wgs, Histophilus somnig+wgs, Klebsiella aerogenesg+p+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatawgs, Legionella pneumophilawgs, Morganella morganiig+wgs, Myroides odoratimimusg+wgs, Neisseria meningitidiswgs, Neisseria siccawgs, Parabacteroides distasoniswgs, Pasteurella multocidag+p+wgs, Phocaeicola doreiwgs, Phocaeicola vulgatuswgs, Proteus columbaeg, Proteus mirabilisg+p+wgs, Proteus pennerig+wgs, Proteus vulgarisg+p+wgs, Providencia alcalifaciensg+wgs, Providencia rettgerig+p+wgs, Providencia stuartiig+p+wgs, Pseudomonas aeruginosag+wgs, Pseudomonas putidag+p, Ralstonia pickettiiwgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shewanella putrefaciensg+p+wgs, Shigella boydiip+wgs, Shigella dysenteriaewgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs, Staphylococcus aureuswgs, Stenotrophomonas maltophiliag+wgs, Streptococcus suiswgs, Vibrio alginolyticusg+p+wgs, Vibrio choleraeg+p+wgs, Vibrio fluvialiswgs, Vibrio harveyip+wgs, Vibrio neocaledonicusg, Vibrio owensiig, Vibrio parahaemolyticusg+p+wgs, Vibrio vulnificuswgs
Classification7 ontology terms | Show
Parent Term(s)11 ontology terms | Show
+ derives_from antibiotic sensitive dihydropteroate synthase
+ confers_resistance_to_antibiotic sulfadiazine [Antibiotic]
+ confers_resistance_to_antibiotic sulfadimidine [Antibiotic]
+ confers_resistance_to_antibiotic sulfadoxine [Antibiotic]
+ confers_resistance_to_antibiotic sulfamethoxazole [Antibiotic]
+ confers_resistance_to_antibiotic sulfisoxazole [Antibiotic]
+ confers_resistance_to_antibiotic sulfacetamide [Antibiotic]
+ confers_resistance_to_antibiotic mafenide [Antibiotic]
+ confers_resistance_to_antibiotic sulfasalazine [Antibiotic]
+ confers_resistance_to_antibiotic sulfamethizole [Antibiotic]
+ sulfonamide resistant sul [AMR Gene Family]
Publications

Skold O. 2001. Vet Res 32(3-4): 261-273. Resistance to trimethoprim and sulfonamides. (PMID 11432417)

Daly M, et al. 2005. J Antimicrob Chemother 55(4): 558-561. Comparison of multidrug resistance gene regions between two geographically unrelated Salmonella serotypes. (PMID 15722395)

Resistomes

Prevalence of sul2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Achromobacter xylosoxidans22.73%0%1.63%0%
Acinetobacter baumannii37.44%3.92%33.77%0%
Acinetobacter defluvii0%12.5%0%0%
Acinetobacter haemolyticus0%2.44%0%0%
Acinetobacter indicus42.86%20.75%15.28%0%
Acinetobacter johnsonii5.26%4.17%20%0%
Acinetobacter junii0%33.33%3.57%0%
Acinetobacter lwoffii0%0%17.39%0%
Acinetobacter nosocomialis0%3.28%9.74%0%
Acinetobacter pittii0%5.26%7.89%0%
Acinetobacter radioresistens0%0%4.88%0%
Acinetobacter towneri12.5%43.75%36.84%0%
Acinetobacter wuhouensis0%9.09%50%0%
Actinobacillus indolicus100%0%100%0%
Actinobacillus pleuropneumoniae6.06%22.22%9.09%0%
Aeromonas caviae3.23%0%2.07%0%
Aeromonas hydrophila4%6.67%4%0%
Aeromonas veronii0%2.33%0%0%
Alcaligenes faecalis12.5%0%15.38%0%
Avibacterium paragallinarum8.33%0%5.88%0%
Bacillus anthracis0%0.37%0%0%
Bacteroides fragilis0%0%1.43%0%
Bacteroides ovatus0%0%1.53%0%
Bacteroides thetaiotaomicron9.09%0%1.61%0%
Bordetella bronchiseptica16.67%0%25.68%0%
Bordetella trematum20%0%0%0%
Burkholderia contaminans0%0%2.56%0%
Chryseobacterium taklimakanense33.33%0%0%0%
Citrobacter amalonaticus0%0%6.25%0%
Citrobacter freundii3.57%6.73%18.1%0%
Citrobacter koseri6.67%6.25%0%0%
Citrobacter portucalensis16%7.58%22.41%0%
Citrobacter werkmanii0%10%33.33%0%
Citrobacter youngae0%0%18.75%0%
Comamonas testosteroni0%0%6.67%0%
Cronobacter dublinensis0%0%2.56%0%
Cronobacter sakazakii0%3.12%0%0%
Elizabethkingia anophelis3.45%0%4.71%0%
Enterobacter asburiae0%0.91%8.44%0%
Enterobacter chengduensis0%0%14.29%0%
Enterobacter cloacae7.69%2.5%17.27%0%
Enterobacter hormaechei1.7%4.62%19.77%0%
Enterobacter kobei0%1.23%12.89%0%
Enterobacter roggenkampii0%0.55%6.48%0%
Escherichia albertii9.09%5.13%7.53%0%
Escherichia coli5.23%4.99%23.09%0%
Escherichia fergusonii3.51%4.14%16.9%0%
Escherichia marmotae0%4.55%0%0%
Glaesserella parasuis26.09%0%20.83%0%
Haemophilus influenzae1.05%0%0%0%
Haemophilus parainfluenzae6.25%0%2.56%0%
Histophilus somni48.28%0%6.9%0%
Klebsiella aerogenes4.65%6.41%5.25%0%
Klebsiella huaxiensis100%0%0%0%
Klebsiella michiganensis5.77%8.15%6.57%0%
Klebsiella oxytoca0%4.92%4.9%0%
Klebsiella pneumoniae2.04%6.79%22.27%0%
Klebsiella quasipneumoniae0%4.31%26.15%0%
Laribacter hongkongensis0%0%4.17%0%
Leclercia adecarboxylata0%0%15%0%
Legionella pneumophila0%0%0.12%0%
Morganella morganii24%0%11.72%0%
Myroides odoratimimus100%0%8.33%0%
Neisseria meningitidis0%0%0.05%0%
Neisseria sicca0%0%7.69%0%
Parabacteroides distasonis0%0%0.68%0%
Pasteurella multocida16.67%5.56%16.53%0%
Phocaeicola dorei0%0%5.68%0%
Phocaeicola vulgatus0%0%2.25%0%
Proteus columbae100%0%0%0%
Proteus mirabilis49.45%16.42%25.8%0%
Proteus penneri50%0%16.67%0%
Proteus vulgaris10%37.5%13.33%0%
Providencia alcalifaciens18.18%0%3.7%0%
Providencia rettgeri15.62%11.11%16.18%0%
Providencia stuartii23.08%14.29%25%0%
Pseudomonas aeruginosa1.13%0%0.44%0%
Pseudomonas putida2%9.52%0%0%
Ralstonia pickettii0%0%1.27%0%
Raoultella planticola0%2.86%2.78%0%
Salmonella enterica6.92%15.81%14.87%0%
Serratia marcescens0%1.99%5.38%0%
Shewanella putrefaciens25%22.22%9.09%0%
Shigella boydii0%4.55%56.04%0%
Shigella dysenteriae0%0%51.85%0%
Shigella flexneri22.58%14.86%47.37%0%
Shigella sonnei0%25%64.15%0%
Staphylococcus aureus0%0%0.01%0%
Stenotrophomonas maltophilia1.37%0%0.86%0%
Streptococcus suis0%0%0.28%0%
Vibrio alginolyticus4.11%3.57%2.67%0%
Vibrio cholerae7.66%23.53%31.4%0%
Vibrio fluvialis0%0%5.48%0%
Vibrio harveyi0%20%2%0%
Vibrio neocaledonicus50%0%0%0%
Vibrio owensii10%0%0%0%
Vibrio parahaemolyticus1.06%0.34%1.74%0%
Vibrio vulnificus0%0%1.21%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAL59753.1|-|sul2 [Vibrio cholerae]
MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPA
TQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTGAGIKRNRLVLDPGMGFF
LGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARI
R


>gb|AY055428.1|-|20269-21084|sul2 [Vibrio cholerae]
ATGAATAAATCGCTCATCATTTTCGGCATCGTCAACATAACCTCGGACAGTTTCTCCGATGGAGGCCGGTATCTGGCGCCAGACGCAGCC
ATTGCGCAGGCGCGTAAGCTGATGGCCGAGGGGGCAGATGTGATCGACCTCGGTCCGGCATCCAGCAATCCCGACGCCGCGCCTGTTTCG
TCCGACACAGAAATCGCGCGTATCGCGCCGGTGCTGGACGCGCTCAAGGCAGATGGCATTCCCGTCTCGCTCGACAGTTATCAACCCGCG
ACGCAAGCCTATGCCTTGTCGCGTGGTGTGGCCTATCTCAATGATATTCGCGGTTTTCCAGACGCTGCGTTCTATCCGCAATTGGCGAAA
TCATCTGCCAAACTCGTCGTTATGCATTCGGTGCAAGACGGGCAGGCAGATCGGCGCGAGGCACCCGCTGGCGACATCATGGATCACATT
GCGGCGTTCTTTGACGCGCGCATCGCGGCGCTGACGGGTGCCGGTATCAAACGCAACCGCCTTGTCCTTGATCCCGGCATGGGGTTTTTT
CTGGGGGCTGCTCCCGAAACCTCGCTCTCGGTGCTGGCGCGGTTCGATGAATTGCGGCTGCGCTTCGATTTGCCGGTGCTTCTGTCTGTT
TCGCGCAAATCCTTTCTGCGCGCGCTCACAGGCCGTGGTCCGGGGGATGTCGGGGCCGCGACACTCGCTGCAGAGCTTGCCGCCGCCGCA
GGTGGAGCTGACTTCATCCGCACACACGAGCCGCGCCCCTTGCGCGACGGGCTGGCGGTATTGGCGGCGCTGAAAGAAACCGCAAGAATT
CGTTAA