sul3

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000413
CARD Short Namesul3
DefinitionSul3 is a sulfonamide resistant dihydropteroate synthase similar to Sul1 and Sul2. Its resistance gene was found encoded in E. coli plasmid DNA of sulfonamide resistant isolates.
AMR Gene Familysulfonamide resistant sul
Drug Classsulfone antibiotic, sulfonamide antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAcinetobacter indicusp, Avibacterium paragallinarumg, Citrobacter freundiiwgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiip, Escherichia albertiip+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp, Klebsiella oxytocap, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiig+wgs+gi, Pasteurella multocidag+gi, Proteus mirabilisg+p+wgs+gi, Providencia rettgeriwgs, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella dysenteriaeg, Shigella flexnerig+p+wgs, Shigella sonneiwgs, Yersinia enterocoliticawgs
Resistomes with Sequence VariantsAcinetobacter indicusp, Avibacterium paragallinarumg, Citrobacter freundiiwgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter roggenkampiip, Escherichia albertiip+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp, Klebsiella oxytocap, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiig+wgs+gi, Pasteurella multocidag+gi, Proteus mirabilisg+p+wgs+gi, Providencia rettgeriwgs, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella dysenteriaeg, Shigella flexnerig+p+wgs, Shigella sonneiwgs, Yersinia enterocoliticawgs
Classification20 ontology terms | Show
Parent Term(s)11 ontology terms | Show
+ confers_resistance_to_antibiotic sulfadiazine [Antibiotic]
+ confers_resistance_to_antibiotic sulfadimidine [Antibiotic]
+ confers_resistance_to_antibiotic sulfadoxine [Antibiotic]
+ confers_resistance_to_antibiotic sulfamethoxazole [Antibiotic]
+ confers_resistance_to_antibiotic sulfisoxazole [Antibiotic]
+ confers_resistance_to_antibiotic sulfacetamide [Antibiotic]
+ confers_resistance_to_antibiotic mafenide [Antibiotic]
+ confers_resistance_to_antibiotic sulfasalazine [Antibiotic]
+ confers_resistance_to_antibiotic sulfamethizole [Antibiotic]
+ derives_from antibiotic sensitive dihydropteroate synthase
+ sulfonamide resistant sul [AMR Gene Family]
Publications

Perreten V and Boerlin P. 2003. Antimicrob Agents Chemother 47(3): 1169-1172. A new sulfonamide resistance gene (sul3) in Escherichia coli is widespread in the pig population of Switzerland. (PMID 12604565)

Resistomes

Prevalence of sul3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter indicus0%1.89%0%0%0%
Avibacterium paragallinarum6.25%0%0%0%0%
Citrobacter freundii0%0%0.39%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%12.5%0%0%
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter cloacae0%0.56%0.96%0%0%
Enterobacter hormaechei0%0.06%0.43%0%0%
Enterobacter roggenkampii0%0.48%0%0%0%
Escherichia albertii0%0.56%2.58%0%0%
Escherichia coli0.45%1.71%8.2%0.89%2.04%
Escherichia fergusonii0%3.91%28.26%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella michiganensis0%0.57%0%0%0%
Klebsiella oxytoca0%1.37%0%0%0%
Klebsiella pneumoniae0.06%0.76%3%0%0%
Klebsiella quasipneumoniae0%0%4.34%0%0%
Morganella morganii1.92%0%1.23%7.69%0%
Pasteurella multocida0.71%0%0%16.67%0%
Proteus mirabilis7.34%1.25%6.44%3.7%0%
Providencia rettgeri0%0%0.64%0%0%
Salmonella enterica1.89%5.69%2.86%2.65%0%
Shigella boydii0%0%6.67%0%0%
Shigella dysenteriae14.29%0%0%0%0%
Shigella flexneri1%6.02%0.16%0%0%
Shigella sonnei0%0%0.73%0%0%
Yersinia enterocolitica0%0%0.91%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|ACJ63260.1|-|sul3 [Escherichia coli]
MSKIFGIVNITTDSFSDGGLYLDTDKAIEHALHLVEDGADVIDLGAASSNPDTTEVGVVEEIKRLKPVIKALKEKGISISVDTFKPEVQS
FCIEQKVDFINDIQGFPYPEIYSGLAKSDCKLVLMHSVQRIGAATKVETNPEEVFTSMMEFFKERIAALVEAGVKRERIILDPGMGFFLG
SNPETSILVLKRFPEIQEAFNLQVMIAVSRKSFLGKITGTDVKSRLAPTLAAEMYAYKKGADYLRTHDVKSLSDALKISKALG


>gb|FJ196385.1|-|8532-9323|sul3 [Escherichia coli]
ATGAGCAAGATTTTTGGAATCGTAAATATAACCACCGATAGTTTTTCCGATGGAGGACTTTATTTAGATACAGATAAGGCAATTGAGCAT
GCTCTGCATTTGGTTGAAGATGGAGCAGATGTGATTGATTTGGGAGCCGCTTCCAGTAATCCTGATACAACTGAAGTGGGCGTTGTGGAA
GAAATCAAAAGACTCAAACCTGTCATTAAGGCTTTAAAAGAAAAAGGCATTTCTATTTCTGTTGATACATTTAAACCTGAGGTTCAGAGT
TTTTGCATAGAACAAAAGGTTGATTTTATTAATGATATTCAAGGTTTTCCTTATCCTGAGATTTATTCAGGCTTGGCAAAGTCAGATTGC
AAACTTGTGTTGATGCACTCCGTTCAGCGAATTGGTGCAGCTACTAAAGTTGAAACGAATCCGGAAGAGGTTTTTACTTCCATGATGGAA
TTTTTTAAAGAAAGAATTGCTGCTTTAGTTGAGGCTGGTGTAAAGCGTGAACGAATTATTCTTGATCCGGGTATGGGCTTCTTTTTAGGC
TCTAATCCAGAAACATCTATTCTTGTTTTGAAGCGTTTCCCTGAAATTCAAGAAGCTTTTAATTTGCAAGTAATGATTGCAGTGTCACGG
AAATCATTCTTAGGTAAAATAACTGGAACCGATGTGAAATCTCGTTTAGCACCAACTCTTGCAGCAGAAATGTATGCATACAAAAAAGGT
GCAGATTATCTCCGCACCCATGATGTTAAGTCTTTATCAGATGCCTTGAAAATATCCAAAGCCCTAGGTTAG

Curator Acknowledgements
Curator Description Most Recent Edit