mtrR

Accession ARO:3000817
CARD Short NamemtrR
DefinitionMtrR is a repressor of mtrCDE expression. Mutations in mtrR increase multidrug resistance.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, major facilitator superfamily (MFS) antibiotic efflux pump
Drug Classantibacterial free fatty acids, penam, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Sequence VariantsNeisseria gonorrhoeaeg+wgs, Neisseria meningitidisg
Classification18 ontology terms | Show
Parent Term(s)3 ontology terms | Show
Publications

Shafer WM, et al. 1995. Microbiology 141(PT 4): 907-911. Missense mutations that alter the DNA-binding domain of the MtrR protein occur frequently in rectal isolates of Neisseria gonorrhoeae that are resistant to faecal lipids. (PMID 7773394)

Resistomes

Prevalence of mtrR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Neisseria gonorrhoeae11.25%0%11.56%0%
Neisseria meningitidis0.76%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 410

Legend:

  • discovered in clinical, agricultural, or environmental isolates

  • discovered via laboratory selection experiments

  • ReSeqTB https://platform.reseqtb.org

Published Variants:


>gb|ACF30254.1|+|mtrR [Neisseria gonorrhoeae NCCP11945]
MRKTKTEALKTKEHLMLAALETFYRKGIARTSLNEIAQAAGVTRGALYWHFKNKEDLFDA
LFQRICDDIENCIAQDAADAEGGSWTVFRHTLLHFFERLQSNDIYYKFHNILFLKCEHTE
QNAAVIAIARKHQAIWREKITAVLTEAVENQDLADDLDKETAVIFIKSTLDGLIWRWFSS
GESFDLGKTAPRIIGIMMDNLENHPCLRRK



>gb|CP001050.1|+|1332867-1333499|mtrR [Neisseria gonorrhoeae NCCP11945]
ATGAGAAAAACCAAAACCGAAGCCTTGAAAACCAAAGAACACCTGATGCTTGCCGCCTTGGAAACCTTTTACCGCAAAGGGATTGCCCGC
ACCTCGCTCAACGAAATCGCCCAAGCCGCCGGCGTAACGCGCGGCGCGCTCTATTGGCATTTCAAAAATAAGGAAGACTTGTTTGACGCG
TTGTTCCAACGTATCTGCGACGACATCGAAAACTGCATCGCGCAAGATGCCGCAGATGCCGAAGGAGGTTCTTGGACGGTATTCCGCCAC
ACGCTGCTGCACTTTTTCGAGCGGCTGCAAAGCAACGACATCTACTACAAATTCCACAACATCCTGTTTTTAAAATGCGAACACACGGAG
CAAAACGCCGCCGTTATCGCCATTGCCCGCAAGCATCAGGCAATCTGGCGCGAGAAAATTACCGCCGTTTTGACCGAAGCGGTGGAAAAT
CAGGATTTGGCTGACGATTTGGACAAGGAAACGGCGGTCATCTTCATCAAATCGACGTTGGACGGGCTGATTTGGCGTTGGTTCTCTTCC
GGCGAAAGTTTCGATTTGGGCAAAACCGCCCCGCGCATCATCGGGATAATGATGGACAACTTGGAAAACCATCCCTGCCTGCGCCGGAAA
TAA