TEM-9

Accession ARO:3000881
Synonym(s)RHH-1
CARD Short NameTEM-9
DefinitionTEM-9 is an extended-spectrum beta-lactamase that has been found in clinical isolates.
AMR Gene FamilyTEM beta-lactamase
Drug Classpenam, penem, cephalosporin, monobactam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesKlebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs
Resistomes with Sequence VariantsKlebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs
Classification17 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ TEM beta-lactamase [AMR Gene Family]
Sub-Term(s)
5 ontology terms | Show
+ tazobactam [Adjuvant] is_small_molecule_inhibitor
+ clavulanic acid [Adjuvant] is_small_molecule_inhibitor
+ sulbactam [Adjuvant] is_small_molecule_inhibitor
+ avibactam [Adjuvant] is_small_molecule_inhibitor
+ ARX1796 [Adjuvant] is_small_molecule_inhibitor
Publications

Spencer RC, et al. 1987. J Antimicrob Chemother 20(6): 919-921. Novel beta-lactamase in a clinical isolate of Klebsiella pneumoniae conferring unusual resistance to beta-lactam antibiotics. (PMID 3326875)

Bauernfeind A and Horl G. 1987. Infection 15(4): 257-259. Novel R-factor borne beta-lactamase of Escherichia coli confering resistance to cephalosporins. (PMID 3312022)

Resistomes

Prevalence of TEM-9 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0%0%
Klebsiella pneumoniae0%0%0.01%0%
Klebsiella quasipneumoniae0%0%0.13%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|WP_102607453.1|+|TEM-9 [Escherichia coli]
MSIQHFRVALIPFFAAFCFPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLG
RRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDE
RNRQIAEIGASLIKHW


>gb|NG_056168.1|+|1-861|TEM-9 [Escherichia coli]
ATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCTTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAA
GTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAGCTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCC
GAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGTGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGT
CGCCGCATACACTATTCTCAGAATGACTTGGTTAAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTA
TGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTG
CACAACATGGGGGATCATGTAACCCGCCTTGATAGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATG
CCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAG
GCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGATCT
CGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACATGACGGGGAGTCAGGCAACTATGGATGAA
CGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAA