IMP-4

Download Sequences

Accession	ARO:3002195
CARD Short Name	IMP-4
Definition	IMP-4 is a beta-lactamase found in Acinetobacter baumannii.
AMR Gene Family	IMP beta-lactamase
Drug Class	penem, penam, cephamycin, cephalosporin, carbapenem
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^p+wgs, Acinetobacter pittii^wgs, Aeromonas caviae^p, Citrobacter amalonaticus^p, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^p, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p, Escherichia coli^p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^p, Raoultella planticola^p+wgs, Serratia marcescens^p
Resistomes with Sequence Variants	Acinetobacter baumannii^p+wgs, Acinetobacter pittii^wgs, Aeromonas caviae^p, Citrobacter amalonaticus^p, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^p, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p, Escherichia coli^p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^p, Raoultella planticola^p+wgs, Serratia marcescens^p
Classification	18 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + antibiotic molecule + hydrolysis of beta-lactam antibiotic by metallo-beta-lactamase + beta-lactam antibiotic + beta-lactamase + cephem + class B (metallo-) beta-lactamase + penem [Drug Class] + subclass B1 (metallo-) beta-lactamase + penam [Drug Class] + cephamycin [Drug Class] + cephalosporin [Drug Class] + carbapenem [Drug Class]
Parent Term(s)	1 ontology terms \| Show + IMP beta-lactamase [AMR Gene Family]
Sub-Term(s)	2 ontology terms \| Show + avibactam [Adjuvant] is_small_molecule_inhibitor + ARX1796 [Adjuvant] is_small_molecule_inhibitor
Publications	Koh TH, et al. 2007. J Antimicrob Chemother 59(4): 627-632. IMP-4 and OXA beta-lactamases in Acinetobacter baumannii from Singapore. (PMID 17284537)

Resistomes

Prevalence of IMP-4 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Acinetobacter baumannii	0%	0.05%	0.01%	0%
Acinetobacter baumannii	0%	0.05%	0.01%	0%
Acinetobacter pittii	0%	0%	0.28%	0%
Acinetobacter pittii	0%	0%	0.28%	0%
Aeromonas caviae	0%	1.3%	0%	0%
Aeromonas caviae	0%	1.3%	0%	0%
Citrobacter amalonaticus	0%	8.33%	0%	0%
Citrobacter amalonaticus	0%	8.33%	0%	0%
Citrobacter freundii	0%	0.92%	0.97%	0%
Citrobacter freundii	0%	0.92%	0.97%	0%
Citrobacter portucalensis	0%	0%	4.5%	0%
Citrobacter portucalensis	0%	0%	4.5%	0%
Enterobacter asburiae	0%	0.28%	0%	0%
Enterobacter asburiae	0%	0.28%	0%	0%
Enterobacter cloacae	0%	0%	0.32%	0%
Enterobacter cloacae	0%	0%	0.32%	0%
Enterobacter hormaechei	0%	0.84%	0.95%	0%
Enterobacter hormaechei	0%	0.84%	0.95%	0%
Enterobacter kobei	0%	0.69%	0%	0%
Enterobacter kobei	0%	0.69%	0%	0%
Escherichia coli	0%	0.03%	0.04%	0%
Escherichia coli	0%	0.03%	0.04%	0%
Klebsiella aerogenes	0%	1.09%	0.56%	0%
Klebsiella aerogenes	0%	1.09%	0.56%	0%
Klebsiella michiganensis	0%	2.29%	0.8%	0%
Klebsiella michiganensis	0%	2.29%	0.8%	0%
Klebsiella pneumoniae	0%	0.17%	0.21%	0%
Klebsiella pneumoniae	0%	0.17%	0.21%	0%
Klebsiella quasipneumoniae	0%	0.42%	0.92%	0%
Klebsiella quasipneumoniae	0%	0.42%	0.92%	0%
Leclercia adecarboxylata	0%	4.76%	0%	0%
Leclercia adecarboxylata	0%	4.76%	0%	0%
Raoultella planticola	0%	2.33%	2.56%	0%
Raoultella planticola	0%	2.33%	2.56%	0%
Serratia marcescens	0%	1.29%	0%	0%
Serratia marcescens	0%	1.29%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400

Protein
DNA

>gb|AAK13078.1|+|IMP-4 [Acinetobacter baumannii]
MSKLSVFFIFLFCSIATAAEPLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVDAEAYLIDTPFTAKDTEKLVTWFVERGYKIKG
SISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFGGVNYWLVKNKIEVFYPGPGHTPDNLVVWLPERKILFGGCFIKP
YGLGNLGDANLEAWPKSAKLLISKYGKAKLVVPSHSEAGDASLLKLTLEQAVKGLNESKKPSKLSN

>gb|AF244145.1|+|1-741|IMP-4 [Acinetobacter baumannii]
ATGAGCAAGTTATCTGTATTCTTTATATTTTTGTTTTGTAGCATTGCTACCGCAGCAGAGCCTTTGCCAGATTTAAAAATTGAAAAACTT
GATGAAGGCGTTTATGTTCATACTTCGTTTGAAGAAGTTAACGGGTGGGGCGTTGTTCCTAAACATGGTTTGGTTGTTCTTGTAGATGCT
GAAGCTTATCTAATTGACACTCCATTTACGGCTAAAGATACTGAAAAGTTAGTCACTTGGTTTGTGGAACGTGGCTATAAAATAAAAGGC
AGTATTTCCTCTCATTTTCATAGTGACAGCACGGGCGGAATAGAGTGGCTTAATTCTCAATCCATCCCCACGTATGCGTCTGAATTAACT
AATGAGCTGCTTAAAAAAGACGGTAAGGTTCAAGCTAAAAATTCATTTGGCGGGGTTAACTATTGGCTAGTTAAAAATAAAATTGAAGTT
TTTTATCCAGGCCCAGGACACACTCCAGATAACCTAGTAGTTTGGCTGCCTGAAAGGAAAATATTATTCGGTGGTTGTTTTATTAAACCG
TACGGTCTAGGTAATTTGGGTGACGCAAATTTAGAAGCTTGGCCAAAGTCCGCTAAATTATTAATATCCAAATATGGTAAGGCAAAACTG
GTTGTTCCAAGTCACAGTGAAGCTGGAGACGCATCACTCTTGAAACTTACATTAGAGCAGGCGGTTAAAGGGTTAAACGAAAGTAAAAAA
CCATCAAAACTAAGCAACTAA

IMP-4

Prevalence: protein homolog model (view sequences)

Graph