VIM-1

Download Sequences

Accession	ARO:3002271
CARD Short Name	VIM-1
Definition	VIM-1 is a beta-lactamase found in Pseudomonas spp.
AMR Gene Family	VIM beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin, carbapenem
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Citrobacter amalonaticus^wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g, Proteus mirabilis^wgs, Providencia rettgeri^wgs, Providencia stuartii^wgs, Pseudomonas aeruginosa^p+wgs, Pseudomonas monteilii^p+wgs, Pseudomonas putida^p+wgs, Raoultella planticola^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^p+wgs, Leclercia adecarboxylata^g+p, Proteus mirabilis^wgs, Providencia rettgeri^wgs, Providencia stuartii^wgs, Pseudomonas aeruginosa^p+wgs, Pseudomonas monteilii^p+wgs, Pseudomonas putida^p+wgs, Raoultella planticola^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs
Classification	15 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + hydrolysis of beta-lactam antibiotic by metallo-beta-lactamase + beta-lactamase + antibiotic molecule + beta-lactam antibiotic + class B (metallo-) beta-lactamase + subclass B1 (metallo-) beta-lactamase + penicillin beta-lactam [Drug Class] + cephalosporin [Drug Class] + carbapenem [Drug Class]
Parent Term(s)	1 ontology terms \| Show + VIM beta-lactamase [AMR Gene Family]
Sub-Term(s)	5 ontology terms \| Show + L-captopril [Adjuvant] is_small_molecule_inhibitor + D-captopril [Adjuvant] is_small_molecule_inhibitor + thiorphan [Adjuvant] is_small_molecule_inhibitor + tiopronin [Adjuvant] is_small_molecule_inhibitor + dimercaprol [Adjuvant] is_small_molecule_inhibitor
Publications	Lauretti L, et al. 1999. Antimicrob Agents Chemother 43(7): 1584-1590. Cloning and characterization of blaVIM, a new integron-borne metallo-beta-lactamase gene from a Pseudomonas aeruginosa clinical isolate. (PMID 10390207)

Resistomes

Prevalence of VIM-1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter freundii	0%	1.23%	6.19%	0%	0%
Citrobacter freundii	0%	1.23%	6.19%	0%	0%
Citrobacter portucalensis	0%	0%	3.6%	0%	0%
Citrobacter portucalensis	0%	0%	3.6%	0%	0%
Enterobacter asburiae	0%	0%	5.14%	0%	0%
Enterobacter asburiae	0%	0%	5.14%	0%	0%
Enterobacter cloacae	0%	1.12%	1.6%	0%	0%
Enterobacter cloacae	0%	1.12%	1.6%	0%	0%
Enterobacter hormaechei	0%	2.64%	2.81%	0%	0%
Enterobacter hormaechei	0%	2.64%	2.76%	0%	0%
Enterobacter kobei	0%	0.69%	0.44%	0%	0%
Enterobacter kobei	0%	0.69%	0.44%	0%	0%
Enterobacter roggenkampii	0%	0%	1.8%	0%	0%
Enterobacter roggenkampii	0%	0%	1.8%	0%	0%
Escherichia coli	0%	0.04%	0.18%	0%	0%
Escherichia coli	0%	0.04%	0.18%	0%	0%
Klebsiella aerogenes	0%	1.09%	0.28%	0%	0%
Klebsiella aerogenes	0%	1.09%	0.28%	0%	0%
Klebsiella michiganensis	0%	0.57%	2.93%	0%	0%
Klebsiella michiganensis	0%	0.57%	2.93%	0%	0%
Klebsiella oxytoca	0%	2.05%	0%	0%	0%
Klebsiella oxytoca	0%	2.05%	0%	0%	0%
Klebsiella pneumoniae	0.06%	0.2%	0.53%	0.95%	0%
Klebsiella pneumoniae	0.06%	0.2%	0.53%	0.95%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.53%	0%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.53%	0%	0%
Leclercia adecarboxylata	7.14%	0%	0%	0%	0%
Leclercia adecarboxylata	7.14%	4.76%	0%	0%	0%
Proteus mirabilis	0%	0%	0.66%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Providencia stuartii	0%	0%	2.27%	0%	0%
Providencia stuartii	0%	0%	2.27%	0%	0%
Pseudomonas aeruginosa	0%	0.58%	0.37%	0%	0%
Pseudomonas aeruginosa	0%	0.58%	0.37%	0%	0%
Pseudomonas monteilii	0%	14.29%	4.76%	0%	0%
Pseudomonas monteilii	0%	14.29%	4.76%	0%	0%
Pseudomonas putida	0%	8%	0.53%	0%	0%
Pseudomonas putida	0%	8%	0.53%	0%	0%
Raoultella planticola	0%	0%	2.56%	0%	0%
Raoultella planticola	0%	0%	2.56%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%
Salmonella enterica	0%	0%	0.01%	0%	0%
Serratia marcescens	0%	0%	3.15%	0%	0%
Serratia marcescens	0%	0%	3.01%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400

Protein
DNA

>gb|AAN63496.1|+|VIM-1 [Pseudomonas aeruginosa]
MLKVISSLLVYMTASVMAVASPLAHSGEPSGEYPTVNEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAK
NTAALLAEIEKQIGLPVTRAVSTHFHDDRVGGVDVLRAAGVATYASPSTRRLAEAEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS
TDNLVVYVPSANVLYGGCAVHELSSTSAGNVADADLAEWPTSVERIQKHYPEAEVVIPGHGLPGGLDLLQHTANVVKAHKNRSVAE

>gb|AF317511.1|+|188-988|VIM-1 [Pseudomonas aeruginosa]
ATGTTAAAAGTTATTAGTAGTTTATTGGTCTACATGACCGCGTCTGTCATGGCTGTCGCAAGTCCGTTAGCCCATTCCGGGGAGCCGAGT
GGTGAGTATCCGACAGTCAACGAAATTCCGGTCGGAGAGGTCCGACTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAG
TCGTTTGATGGCGCGGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAA
AACACAGCGGCACTTCTCGCGGAGATTGAAAAGCAAATTGGACTTCCCGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTC
GGCGGCGTTGATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGCAGAGGGGAACGAGATT
CCCACGCATTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAGCTCTTCTATCCTGGTGCTGCGCATTCG
ACCGACAATCTGGTTGTATACGTCCCGTCAGCGAACGTGCTATACGGTGGTTGTGCCGTTCATGAGTTGTCAAGCACGTCTGCGGGGAAC
GTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCGTTGAGCGGATTCAAAAACACTACCCGGAAGCAGAGGTCGTCATTCCCGGGCAC
GGTCTACCGGGCGGTCTAGACTTGCTCCAGCACACAGCGAACGTTGTCAAAGCACACAAAAATCGCTCAGTCGCCGAGTAG

Curator Acknowledgements

Curator	Description	Most Recent Edit

VIM-1

Prevalence: protein homolog model (view sequences)

Graph