APH(3')-VIa

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002652
Synonym(s)aphA-6
CARD Short NameAPH(3')-VIa
DefinitionAPH(3')-VIa is a plasmid-encoded aminoglycoside phosphotransferase in A. baumannii.
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONAcinetobacter baumannii (2)
GAZ
FOODON
ENVO
UBERON
Classification13 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ confers_resistance_to_antibiotic neomycin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic ribostamycin [Antibiotic]
+ confers_resistance_to_antibiotic butirosin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ confers_resistance_to_antibiotic paromomycin [Antibiotic]
+ APH(3')-VI
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter defluviip, Acinetobacter haemolyticusp, Acinetobacter indicusg, Acinetobacter johnsoniip+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiip, Acinetobacter nosocomialisp+wgs, Acinetobacter pittiip+wgs, Acinetobacter radioresistenswgs, Acinetobacter wuhouensisp, Citrobacter freundiiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Pseudomonas aeruginosag+wgs, Pseudomonas putidawgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Acinetobacter defluviip, Acinetobacter haemolyticusp+wgs, Acinetobacter indicusg+p+wgs, Acinetobacter johnsoniip+wgs, Acinetobacter juniip+wgs, Acinetobacter lwoffiip+wgs, Acinetobacter nosocomialisp+wgs, Acinetobacter pittiip+wgs, Acinetobacter radioresistenswgs, Acinetobacter townerip+wgs, Acinetobacter wuhouensisp+wgs, Actinobacillus pleuropneumoniaeg, Aeromonas caviaeg, Alcaligenes faecalisp+wgs, Burkholderia cenocepaciawgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs+gi, Pasteurella multocidawgs, Proteus mirabilisg+p+wgs, Providencia rettgerip+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs+gi, Pseudomonas monteiliiwgs, Pseudomonas putidag+wgs, Salmonella entericawgs, Serratia marcescenswgs, Stenotrophomonas maltophiliag+wgs, Stutzerimonas stutzeriwgs
Publications

Martin P, et al. 1988. Mol Microbiol 2(5): 615-625. Nucleotide sequence of Acinetobacter baumannii aphA-6 gene: evolutionary and functional implications of sequence homologies with nucleotide-binding proteins, kinases and other aminoglycoside-modifying enzymes. (PMID 2846986)

Resistomes

Prevalence of APH(3')-VIa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii7.08%3.9%21.81%3.77%0%
Acinetobacter defluvii0%12.5%0%0%0%
Acinetobacter haemolyticus0%4.88%4.65%0%0%
Acinetobacter indicus4.76%18.87%2.6%0%0%
Acinetobacter johnsonii0%4.17%14.55%0%0%
Acinetobacter junii0%50%8.96%0%0%
Acinetobacter lwoffii0%1.39%5.26%0%0%
Acinetobacter nosocomialis0%3.28%5.75%0%0%
Acinetobacter pittii0%9.36%8.24%0%0%
Acinetobacter radioresistens0%0%3.51%0%0%
Acinetobacter towneri0%6.25%3.85%0%0%
Acinetobacter wuhouensis0%4.55%50%0%0%
Actinobacillus pleuropneumoniae2.78%0%0%0%0%
Aeromonas caviae2.27%0%0%0%0%
Alcaligenes faecalis0%20%2.94%0%0%
Burkholderia cenocepacia0%0%4.82%0%0%
Citrobacter amalonaticus0%0%9.09%0%0%
Citrobacter freundii0%0%1.35%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Citrobacter werkmanii0%0%46.15%0%0%
Enterobacter asburiae0%0%0.4%0%0%
Enterobacter cloacae0%0%0.32%0%0%
Enterobacter hormaechei0%0.19%2.16%0%0%
Enterobacter kobei0%0%0.87%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia coli0.05%0.1%0.19%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella michiganensis0%0%0.8%0%0%
Klebsiella oxytoca0%0%1.26%0%0%
Klebsiella pneumoniae0.18%0.79%2.22%0%0%
Klebsiella quasipneumoniae0%0.21%1.45%0%0%
Morganella morganii1.92%0%1.84%7.69%0%
Pasteurella multocida0%0%1.5%0%0%
Proteus mirabilis4.59%5%3.3%0%0%
Providencia rettgeri0%2.7%5.73%0%0%
Providencia stuartii0%0%9.09%0%0%
Pseudomonas aeruginosa2.45%0.29%1.78%9.72%0%
Pseudomonas monteilii0%0%16.67%0%0%
Pseudomonas putida1.41%0%6.42%0%0%
Salmonella enterica0%0%0.02%0%0%
Serratia marcescens0%0%1.7%0%0%
Stenotrophomonas maltophilia1.12%0%0.15%0%0%
Stutzerimonas stutzeri0%0%0.76%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAA30578.1|+|APH(3')-VIa [Acinetobacter baumannii]
MELPNIIQQFIGNSVLEPNKIGQSPSDVYSFNRNNETFFLKRSSTLYTETTYSVSREAKMLSWLSEKLKVPELIMTFQDEQFEFMITKAI
NAKPISALFLTDQELLAIYKEALNLLNSIAIIDCPFISNIDHRLKESKFFIDNQLLDDIDQDDFDTELWGDHKTYLSLWNELTETRVEER
LVFSHGDITDSNIFIDKFNEIYFLDLGRAGLADEFVDISFVERCLREDASEETAKIFLKHLKNDRPDKRNYFLKLDELN


>gb|X07753.1|+|103-882|APH(3')-VIa [Acinetobacter baumannii]
ATGGAATTGCCCAATATTATTCAACAATTTATCGGAAACAGCGTTTTAGAGCCAAATAAAATTGGTCAGTCGCCATCGGATGTTTATTCT
TTTAATCGAAATAATGAAACTTTTTTTCTTAAGCGATCTAGCACTTTATATACAGAGACCACATACAGTGTCTCTCGTGAAGCGAAAATG
TTGAGTTGGCTCTCTGAGAAATTAAAGGTGCCTGAACTCATCATGACTTTTCAGGATGAGCAGTTTGAATTCATGATCACTAAAGCGATC
AATGCAAAACCAATTTCAGCGCTTTTTTTAACAGACCAAGAATTGCTTGCTATCTATAAGGAGGCACTCAATCTGTTAAATTCAATTGCT
ATTATTGATTGTCCATTTATTTCAAACATTGATCATCGGTTAAAAGAGTCAAAATTTTTTATTGATAACCAACTCCTTGACGATATAGAT
CAAGATGATTTTGACACTGAATTATGGGGAGACCATAAAACTTACCTAAGTCTATGGAATGAGTTAACCGAGACTCGTGTTGAAGAAAGA
TTGGTTTTTTCTCATGGCGATATCACGGATAGTAATATTTTTATAGATAAATTCAATGAAATTTATTTTTTAGATCTTGGTCGTGCTGGG
TTAGCAGATGAATTTGTAGATATATCCTTTGTTGAACGTTGCCTAAGAGAGGATGCATCGGAGGAAACTGCGAAAATATTTTTAAAGCAT
TTAAAAAATGATAGACCTGACAAAAGGAATTATTTTTTAAAACTTGATGAATTGAATTGA

Curator Acknowledgements
Curator Description Most Recent Edit