APH(3')-VIa

Accession ARO:3002652
Synonym(s)aphA-6
DefinitionAPH(3')-VIa is a plasmid-encoded aminoglycoside phosphotransferase in A. baumannii
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
ResistomesAcinetobacter baumanniig+p+wgs, Acinetobacter haemolyticusp, Acinetobacter nosocomialisp+wgs, Escherichia colip, Pseudomonas aeruginosag+wgs, Pseudomonas fluorescenswgs
Classification12 ontology terms | Show
Parent Term(s)8 ontology terms | Show
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic ribostamycin [Antibiotic]
+ confers_resistance_to_antibiotic butirosin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ APH(3') [AMR Gene Family]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ confers_resistance_to_antibiotic paromomycin [Antibiotic]
Publications

Martin P, et al. 1988. Mol Microbiol 2(5): 615-625. Nucleotide sequence of Acinetobacter baumannii aphA-6 gene: evolutionary and functional implications of sequence homologies with nucleotide-binding proteins, kinases and other aminoglycoside-modifying enzymes. (PMID 2846986)

Resistomes

Prevalence of APH(3')-VIa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 85 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii5.73%5.52%21.15%
Acinetobacter haemolyticus0%6.67%0%
Acinetobacter nosocomialis0%2%2%
Burkholderia cepacia0%0%0.82%
Citrobacter freundii0%0%0.78%
Enterobacter cloacae0%0%0.23%
Enterobacter hormaechei0%0%0.95%
Enterococcus faecium0%0%0.07%
Escherichia coli0%0.02%0.01%
Klebsiella pneumoniae0%0.07%0.17%
Proteus mirabilis0%0%3.45%
Pseudomonas aeruginosa1.87%0%0.97%
Pseudomonas fluorescens0%0%0.73%
Pseudomonas putida0%0%2.5%
Salmonella enterica0%0.12%0%
Serratia marcescens0%0%3.92%
Vibrio parahaemolyticus0%0%0.08%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|CAA30578.1|+|APH(3')-VIa [Acinetobacter baumannii]
MELPNIIQQFIGNSVLEPNKIGQSPSDVYSFNRNNETFFLKRSSTLYTETTYSVSREAKMLSWLSEKLKVPELIMTFQDEQFEFMITKAI
NAKPISALFLTDQELLAIYKEALNLLNSIAIIDCPFISNIDHRLKESKFFIDNQLLDDIDQDDFDTELWGDHKTYLSLWNELTETRVEER
LVFSHGDITDSNIFIDKFNEIYFLDLGRAGLADEFVDISFVERCLREDASEETAKIFLKHLKNDRPDKRNYFLKLDELN


>gb|X07753|+|103-882|APH(3')-VIa [Acinetobacter baumannii]
ATGGAATTGCCCAATATTATTCAACAATTTATCGGAAACAGCGTTTTAGAGCCAAATAAAATTGGTCAGTCGCCATCGGATGTTTATTCT
TTTAATCGAAATAATGAAACTTTTTTTCTTAAGCGATCTAGCACTTTATATACAGAGACCACATACAGTGTCTCTCGTGAAGCGAAAATG
TTGAGTTGGCTCTCTGAGAAATTAAAGGTGCCTGAACTCATCATGACTTTTCAGGATGAGCAGTTTGAATTCATGATCACTAAAGCGATC
AATGCAAAACCAATTTCAGCGCTTTTTTTAACAGACCAAGAATTGCTTGCTATCTATAAGGAGGCACTCAATCTGTTAAATTCAATTGCT
ATTATTGATTGTCCATTTATTTCAAACATTGATCATCGGTTAAAAGAGTCAAAATTTTTTATTGATAACCAACTCCTTGACGATATAGAT
CAAGATGATTTTGACACTGAATTATGGGGAGACCATAAAACTTACCTAAGTCTATGGAATGAGTTAACCGAGACTCGTGTTGAAGAAAGA
TTGGTTTTTTCTCATGGCGATATCACGGATAGTAATATTTTTATAGATAAATTCAATGAAATTTATTTTTTAGATCTTGGTCGTGCTGGG
TTAGCAGATGAATTTGTAGATATATCCTTTGTTGAACGTTGCCTAAGAGAGGATGCATCGGAGGAAACTGCGAAAATATTTTTAAAGCAT
TTAAAAAATGATAGACCTGACAAAAGGAATTATTTTTTAAAACTTGATGAATTGAATTGA