APH(3')-VIb

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002653
CARD Short NameAPH(3')-VIb
DefinitionAPH(3')-VIb is a plasmid-encoded aminoglycoside phosphotransferase in K. pneumoniae and S. marcescens.
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Classification13 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ confers_resistance_to_antibiotic neomycin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic ribostamycin [Antibiotic]
+ confers_resistance_to_antibiotic butirosin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ confers_resistance_to_antibiotic paromomycin [Antibiotic]
+ APH(3')-VI
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter pittiip+wgs, Proteus mirabilisg+wgs, Pseudomonas aeruginosawgs, Pseudomonas putidawgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter pittiip+wgs, Citrobacter freundiig+p+wgs, Citrobacter portucalensiswgs, Enterobacter chengduensiswgs, Enterobacter hormaecheip, Escherichia colip+wgs, Klebsiella huaxiensisp, Klebsiella oxytocap, Klebsiella pneumoniaep+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs, Proteus penneriwgs, Providencia rettgerig, Pseudomonas aeruginosawgs, Pseudomonas putidawgs
Publications

Gaynes R, et al. 1988. Antimicrob Agents Chemother 32(9): 1379-1384. Isolation, characterization, and cloning of a plasmid-borne gene encoding a phosphotransferase that confers high-level amikacin resistance in enteric bacilli. (PMID 2848443)

Resistomes

Prevalence of APH(3')-VIb among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii1.06%0.16%1.11%0%0%
Acinetobacter pittii0%0.49%1.7%0%0%
Citrobacter freundii1.64%0.31%1.16%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Enterobacter chengduensis0%0%4%0%0%
Enterobacter hormaechei0%0.06%0%0%0%
Escherichia coli0%0.01%0.01%0%0%
Klebsiella huaxiensis0%7.69%0%0%0%
Klebsiella oxytoca0%0.68%0%0%0%
Klebsiella pneumoniae0%0.26%0.54%0%0%
Morganella morganii1.92%0%0.61%0%0%
Proteus mirabilis0.92%0%0.5%0%0%
Proteus penneri0%0%12.5%0%0%
Providencia rettgeri5.88%0%0%0%0%
Pseudomonas aeruginosa0%0%0.28%0%0%
Pseudomonas putida0%0%0.53%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAF29483.1|+|APH(3')-VIb [Alcaligenes faecalis]
MELPNIIQQFIGNSVLEPNKIGQSPSDVYSFNRNNETFFLKRSSTLYTETTYSVSREAKMLSWLSDKLKVPELIMTFQDEQFEFMITKAI
NAKSISALFLTEQELLAIYKETLNQLNAVAIIDCPFISSIDHRLKESKFFIDNQLLDEIDQDDFEAELWGDHKTYISLWNELNETRVEER
LVFSHGDITDSNIFIDKSGEIYFLDLGRAGLADEFVDISFVERCLREDVSEETAKIFLKHLKNDMPDKRNYFLKLDELN


>gb|AJ627643.4|+|4934-5713|APH(3')-VIb [Alcaligenes faecalis]
ATGGAATTGCCCAATATTATTCAACAATTTATTGGAAACAGCGTTTTAGAGCCAAATAAAATTGGTCAGTCGCCATCGGATGTTTATTCT
TTTAATCGAAATAATGAAACTTTTTTTCTTAAGCGATCTAGCACTTTATATACAGAGACCACATACAGTGTCTCTCGTGAAGCGAAAATG
TTGAGTTGGCTCTCTGATAAATTAAAGGTGCCTGAACTCATCATGACTTTTCAGGATGAGCAGTTTGAATTCATGATCACTAAAGCGATC
AATGCAAAATCAATTTCAGCGCTTTTTTTAACAGAGCAAGAATTGCTTGCTATCTATAAGGAAACACTCAATCAGTTAAATGCAGTTGCT
ATTATTGATTGCCCATTTATTTCAAGCATTGATCATCGGTTAAAAGAGTCAAAATTTTTTATTGATAACCAACTCCTTGACGAGATAGAT
CAAGATGATTTTGAGGCTGAATTATGGGGAGACCATAAAACTTACATAAGTCTTTGGAATGAGTTAAATGAGACTCGTGTTGAAGAAAGA
TTGGTTTTTTCTCATGGCGATATCACGGATAGTAATATTTTTATAGATAAATCTGGTGAAATTTACTTTTTAGATCTTGGTCGTGCTGGA
TTAGCAGATGAATTTGTAGATATATCTTTTGTTGAACGTTGCCTAAGAGAGGATGTATCTGAGGAAACTGCTAAAATATTTTTAAAGCAT
TTAAAAAACGATATGCCTGACAAAAGGAATTATTTTTTAAAACTTGATGAATTGAATTGA

Curator Acknowledgements
Curator Description Most Recent Edit