Escherichia coli gyrA conferring resistance to fluoroquinolones

Accession ARO:3003294
DefinitionPoint mutation of Escherichia coli gyrA resulted in the lowered affinity between fluoroquinolones and gyrA. Thus, conferring resistance
AMR Gene Familyfluoroquinolone resistant gyrA
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target alteration
Classification12 ontology terms | Show
Parent Term(s)14 ontology terms | Show
+ fluoroquinolone resistant gyrA [AMR Gene Family]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic enoxacin [Antibiotic]
+ confers_resistance_to_antibiotic gatifloxacin [Antibiotic]
+ confers_resistance_to_antibiotic grepafloxacin [Antibiotic]
+ confers_resistance_to_antibiotic levofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic lomefloxacin [Antibiotic]
+ confers_resistance_to_antibiotic moxifloxacin [Antibiotic]
+ confers_resistance_to_antibiotic nalidixic acid [Antibiotic]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic ofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic pefloxacin [Antibiotic]
+ confers_resistance_to_antibiotic sparfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic trovafloxacin [Antibiotic]
Publications

Nawaz M, et al. 2015. Int J Antimicrob Agents 45(5): 471-476. Characterisation of novel mutations involved in quinolone resistance in Escherichia coli isolated from imported shrimp. (PMID 25631675)

Cullen ME, et al. 1989. Antimicrob. Agents Chemother. 33(6):886-94 Cloning and characterization of a DNA gyrase A gene from Escherichia coli that confers clinical resistance to 4-quinolones. (PMID 2548439)

Heisig P, et al. 1993. Antimicrob. Agents Chemother. 37(4):696-701 Mutations in the gyrA gene of a highly fluoroquinolone-resistant clinical isolate of Escherichia coli. (PMID 8388197)

Oram M and Fisher LM. 1991. Antimicrob Agents Chemother 35(2): 387-389. 4-Quinolone resistance mutations in the DNA gyrase of Escherichia coli clinical isolates identified by using the polymerase chain reaction. (PMID 1850972)

Vila J, et al. 1994. Antimicrob. Agents Chemother. 38(10):2477-9 Association between double mutation in gyrA gene of ciprofloxacin-resistant clinical isolates of Escherichia coli and MICs. (PMID 7840592)

Yoshida H, et al. 1990. Antimicrob. Agents Chemother. 34(6):1271-2 Quinolone resistance-determining region in the DNA gyrase gyrA gene of Escherichia coli. (PMID 2168148)

Resistomes

Prevalence of Escherichia coli gyrA conferring resistance to fluoroquinolones among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii34.48%0%42.64%
Enterobacter asburiae0%0%23.44%
Enterobacter cloacae10%0%10.38%
Enterobacter hormaechei8.11%0%21.24%
Enterobacter kobei33.33%0%1.56%
Escherichia coli2.32%0%20.13%
Klebsiella oxytoca22.22%0%36.45%
Klebsiella pneumoniae0%0%0%
Morganella morganii0%0%2.38%
Raoultella planticola40%0%10.53%
Salmonella enterica0%0%0.03%
Shigella dysenteriae5.56%0%5.71%
Shigella flexneri30.3%0%31.17%
Shigella sonnei20%0%13.49%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 1500

PMID: 25631675S83I S83L D87Y D87G D87N D87H
PMID: 2548439A67S S83W Q106H
PMID: 8388197S83L
PMID: 1850972S83W D87V
PMID: 7840592S83L,D87N S83L,D87Y
PMID: 2168148A67S G81C A84P Q106H

>gb|AAC75291.1|-|Escherichia coli gyrA conferring resistance to fluoroquinolones [Escherichia coli str. K-12 substr. MG1655]
MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWN
KAYKKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAM
RYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMPTKIPNLLVNGSSGIAVGMAT
NIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKV
YIRARAEVEVDAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDG
MRIVIEVKRDAVGEVVLNNLYSQTQLQVSFGINMVALHHGQPKIMNLKDIIAAFVRHRRE
VVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHAPTPAEAKTALVANPWQLGNV
AAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKE
LLDQIAELLRILGSADRLMEVIREELELVREQFGDKRRTEITANSADINLEDLITQEDVV
VTLSHQGYVKYQPLSEYEAQRRGGKGKSAARIKEEDFIDRLLVANTHDHILCFSSRGRVY
SMKVYQLPEATRGARGRPIVNLLPLEQDERITAILPVTEFEEGVKVFMATANGTVKKTVL
TEFNRLRTAGKVAIKLVDGDELIGVDLTSGEDEVMLFSAEGKVVRFKESSVRAMGCNTTG
VRGIRLGEGDKVVSLIVPRGDGAILTATQNGYGKRTAVAEYPTKSRATKGVISIKVTERN
GLVVGAVQVDDCDQIMMITDAGTLVRTRVSEISIVGRNTQGVILIRTAEDENVVGLQRVA
EPVDEEDLDTIDGSAAEGDDEIAPEVDVDDEPEEE



>gb|U00096.3|-|2336793-2339420|Escherichia coli gyrA conferring resistance to fluoroquinolones [Escherichia coli str. K-12 substr. MG1655]
ATGAGCGACCTTGCGAGAGAAATTACACCGGTCAACATTGAGGAAGAGCTGAAGAGCTCCTATCTGGATTATGCGATGTCGGTCATTGTT
GGCCGTGCGCTGCCAGATGTCCGAGATGGCCTGAAGCCGGTACACCGTCGCGTACTTTACGCCATGAACGTACTAGGCAATGACTGGAAC
AAAGCCTATAAAAAATCTGCCCGTGTCGTTGGTGACGTAATCGGTAAATACCATCCCCATGGTGACTCGGCGGTCTATGACACGATCGTC
CGCATGGCGCAGCCATTCTCGCTGCGTTATATGCTGGTAGACGGTCAGGGTAACTTCGGTTCTATCGACGGCGACTCTGCGGCGGCAATG
CGTTATACGGAAATCCGTCTGGCGAAAATTGCCCATGAACTGATGGCCGATCTCGAAAAAGAGACGGTCGATTTCGTTGATAACTATGAC
GGCACGGAAAAAATTCCGGACGTCATGCCAACCAAAATTCCTAACCTGCTGGTGAACGGTTCTTCCGGTATCGCCGTAGGTATGGCAACC
AACATCCCGCCGCACAACCTGACGGAAGTCATCAACGGTTGTCTGGCGTATATTGATGATGAAGACATCAGCATTGAAGGGCTGATGGAA
CACATCCCGGGGCCGGACTTCCCGACGGCGGCAATCATTAACGGTCGTCGCGGTATTGAAGAAGCTTACCGTACCGGTCGCGGCAAGGTG
TATATCCGCGCTCGCGCAGAAGTGGAAGTTGACGCCAAAACCGGTCGTGAAACCATTATCGTCCACGAAATTCCGTATCAGGTAAACAAA
GCGCGCCTGATCGAGAAGATTGCGGAACTGGTAAAAGAAAAACGCGTGGAAGGCATCAGCGCGCTGCGTGACGAGTCTGACAAAGACGGT
ATGCGCATCGTGATTGAAGTGAAACGCGATGCGGTCGGTGAAGTTGTGCTCAACAACCTCTACTCCCAGACCCAGTTGCAGGTTTCTTTC
GGTATCAACATGGTGGCATTGCACCATGGTCAGCCGAAGATCATGAACCTGAAAGACATCATCGCGGCGTTTGTTCGTCACCGCCGTGAA
GTGGTGACCCGTCGTACTATTTTCGAACTGCGTAAAGCTCGCGATCGTGCTCATATCCTTGAAGCATTAGCCGTGGCGCTGGCGAACATC
GACCCGATCATCGAACTGATCCGTCATGCGCCGACGCCTGCAGAAGCGAAAACTGCGCTGGTTGCTAATCCGTGGCAGCTGGGCAACGTT
GCCGCGATGCTCGAACGTGCTGGCGACGATGCTGCGCGTCCGGAATGGCTGGAGCCAGAGTTCGGCGTGCGTGATGGTCTGTACTACCTG
ACCGAACAGCAAGCTCAGGCGATTCTGGATCTGCGTTTGCAGAAACTGACCGGTCTTGAGCACGAAAAACTGCTCGACGAATACAAAGAG
CTGCTGGATCAGATCGCGGAACTGTTGCGTATTCTTGGTAGCGCCGATCGTCTGATGGAAGTGATCCGTGAAGAGCTGGAGCTGGTTCGT
GAACAGTTCGGTGACAAACGTCGTACTGAAATCACCGCCAACAGCGCAGACATCAACCTGGAAGATCTGATCACCCAGGAAGATGTGGTC
GTGACGCTCTCTCACCAGGGCTACGTTAAGTATCAGCCGCTTTCTGAATACGAAGCGCAGCGTCGTGGCGGGAAAGGTAAATCTGCCGCA
CGTATTAAAGAAGAAGACTTTATCGACCGACTGCTGGTGGCGAACACTCACGACCATATTCTGTGCTTCTCCAGCCGTGGTCGCGTCTAT
TCGATGAAAGTTTATCAGTTGCCGGAAGCCACTCGTGGCGCGCGCGGTCGTCCGATCGTCAACCTGCTGCCGCTGGAGCAGGACGAACGT
ATCACTGCGATCCTGCCAGTGACCGAGTTTGAAGAAGGCGTGAAAGTCTTCATGGCGACCGCTAACGGTACCGTGAAGAAAACTGTCCTC
ACCGAGTTCAACCGTCTGCGTACCGCCGGTAAAGTGGCGATCAAACTGGTTGACGGCGATGAGCTGATCGGCGTTGACCTGACCAGCGGC
GAAGACGAAGTAATGCTGTTCTCCGCTGAAGGTAAAGTGGTGCGCTTTAAAGAGTCTTCTGTCCGTGCGATGGGCTGCAACACCACCGGT
GTTCGCGGTATTCGCTTAGGTGAAGGCGATAAAGTCGTCTCTCTGATCGTGCCTCGTGGCGATGGCGCAATCCTCACCGCAACGCAAAAC
GGTTACGGTAAACGTACCGCAGTGGCGGAATACCCAACCAAGTCGCGTGCGACGAAAGGGGTTATCTCCATCAAGGTTACCGAACGTAAC
GGTTTAGTTGTTGGCGCGGTACAGGTAGATGACTGCGACCAGATCATGATGATCACCGATGCCGGTACGCTGGTACGTACTCGCGTTTCG
GAAATCAGCATCGTGGGCCGTAACACCCAGGGCGTGATCCTCATCCGTACTGCGGAAGATGAAAACGTAGTGGGTCTGCAACGTGTTGCT
GAACCGGTTGACGAGGAAGATCTGGATACCATCGACGGCAGTGCCGCGGAAGGGGACGATGAAATCGCTCCGGAAGTGGACGTTGACGAC
GAGCCAGAAGAAGAATAA