Streptococcus pneumoniae parC conferring resistance to fluoroquinolone

Accession ARO:3003311
DefinitionPoint mutation in Streptococcus pneumoniae parC resulting in fluoroquinolone resistance
AMR Gene Familyfluoroquinolone resistant parC
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target alteration
Classification12 ontology terms | Show
Parent Term(s)14 ontology terms | Show
+ fluoroquinolone resistant parC [AMR Gene Family]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic enoxacin [Antibiotic]
+ confers_resistance_to_antibiotic gatifloxacin [Antibiotic]
+ confers_resistance_to_antibiotic grepafloxacin [Antibiotic]
+ confers_resistance_to_antibiotic levofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic lomefloxacin [Antibiotic]
+ confers_resistance_to_antibiotic moxifloxacin [Antibiotic]
+ confers_resistance_to_antibiotic nalidixic acid [Antibiotic]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic ofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic pefloxacin [Antibiotic]
+ confers_resistance_to_antibiotic sparfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic trovafloxacin [Antibiotic]
Publications

Tankovic J, et al. 1996. Antimicrob Agents Chemother 40(11): 2505-2510. Contribution of mutations in gyrA and parC genes to fluoroquinolone resistance of mutants of Streptococcus pneumoniae obtained in vivo and in vitro. (PMID 8913454)

Resistomes

Prevalence of Streptococcus pneumoniae parC conferring resistance to fluoroquinolone among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 1400

PMID: 8913454S80Y S80F D84H

>gb|AAK74984.1|+|Streptococcus pneumoniae parC conferring resistance to fluoroquinolone [Streptococcus pneumoniae TIGR4]
MSNIQNMSLEDIMGERFGRYSKYIIQDRALPDIRDGLKPVQRRILYSMNKDSNTFDKSYR
KSAKSVGNIMGNFHPHGDSSIYDAMVRMSQNWKNREILVEMHGNNGSMDGDPPAAMRYTE
ARLSEIAGYLLQDIEKKTVPFAWNFDDTEKEPTVLPAAFPNLLVNGSTGISAGYATDIPP
HNLAEVIDAAVYMIDHPTAKIDKLMEFLPGPDFPTGAIIQGRDEIKKAYETGKGRVVVRS
KTEIEKLKGGKEQIVIIEIPYEINKANLVKKIDDVRVNNKVAGIAEVRDESDRDGLRIAI
ELKKDANTELVLNYLFKYTDLQINYNFNMVAIDNFTPRQVGIVPILSSYIAHRREVILAR
SRFDKEKAEKRLHIVEGLIRVISILDEVIALIRASENKADAKENLKVSYDFTEEQAEAIV
TLQLYRLTNTDVVVLQEEEAELREKIAMLAAIIGDERTMYNLMKKELREVKKKFATPRLS
SLEDTAKAIEIDTASLIAEEDTYVSVTKAGYIKRTSPRSFAASTLEEIGKRDDDRLIFVQ
SAKTTQHLLMFTSLGNVIYRPIHELADIRWKDIGEHLSQTITNFETNEEILYVEVLDQFD
DATTYFAVTRLGQIKRVERKEFTPWRTYRSKSVKYAKLKDDTDQIVAVAPIKLDDVVLVS
QNGYALRFNIEEVPVVGAKAAGVKAMNLKEDDVLQSGFICNTSSFYLLTQRGSLKRVSIE
EILATSRAKRGLQVLRELKNKPHRVFLAGAVAEQGFVGDFFSTEVDVNDQTLLVQSNKGT
IYESRLQDLNLSERTSNGSFISDTISDEEVFDAYLQEVVTEDK



>gb|AE005672|+|800700-803171|Streptococcus pneumoniae parC conferring resistance to fluoroquinolone [Streptococcus pneumoniae TIGR4]
ATGTCTAACATTCAAAACATGTCCCTGGAGGACATCATGGGAGAGCGCTTTGGTCGCTACTCCAAGTACATTATTCAAGACCGGGCTTTG
CCAGATATTCGTGATGGGTTGAAGCCGGTTCAGCGCCGTATTCTTTATTCTATGAATAAGGATAGCAATACTTTTGACAAGAGCTACCGT
AAGTCGGCCAAGTCAGTCGGGAACATCATGGGGAATTTCCACCCACACGGGGATTCTTCTATCTATGATGCCATGGTTCGTATGTCACAG
AACTGGAAAAATCGTGAGATTCTAGTTGAAATGCACGGTAATAACGGTTCTATGGACGGAGATCCTCCTGCGGCTATGCGTTATACTGAG
GCACGTTTGTCTGAAATTGCAGGCTACCTTCTTCAGGATATCGAGAAAAAGACAGTTCCTTTTGCATGGAACTTTGACGATACGGAGAAA
GAACCAACGGTCTTGCCAGCAGCCTTTCCAAACCTCTTGGTCAATGGTTCGACTGGGATTTCGGCTGGTTATGCCACAGACATTCCTCCC
CATAATTTAGCTGAGGTCATAGATGCTGCAGTTTACATGATTGACCACCCAACTGCAAAGATTGATAAACTCATGGAATTCTTGCCTGGA
CCAGACTTCCCTACAGGGGCTATTATTCAGGGTCGTGATGAAATCAAGAAAGCTTATGAGACTGGGAAAGGGCGCGTGGTTGTTCGTTCC
AAGACTGAAATTGAAAAGCTAAAAGGTGGTAAGGAACAAATCGTTATTATTGAGATTCCTTATGAAATCAATAAGGCCAATCTAGTCAAG
AAAATCGATGATGTTCGTGTTAATAACAAGGTAGCTGGGATTGCTGAGGTTCGTGATGAGTCTGACCGTGATGGTCTTCGTATCGCTATC
GAACTTAAGAAAGACGCTAATACTGAGCTTGTTCTCAACTACTTATTTAAGTACACCGACCTACAAATCAACTACAACTTTAATATGGTG
GCGATTGACAATTTCACACCTCGTCAGGTTGGGATTGTTCCAATCCTGTCTAGCTATATCGCTCACCGTCGAGAAGTGATTTTGGCGCGT
TCACGCTTTGACAAAGAAAAGGCTGAGAAACGTCTCCATATCGTCGAAGGTTTGATTCGTGTGATTTCGATTTTGGATGAAGTCATTGCT
CTTATCCGTGCTTCTGAGAATAAGGCGGACGCCAAGGAAAACCTCAAAGTTAGCTATGATTTTACGGAAGAACAGGCTGAGGCTATCGTA
ACTTTGCAACTGTACCGTTTGACCAATACCGATGTGGTTGTCTTGCAGGAAGAAGAAGCAGAGCTTCGTGAGAAGATTGCTATGCTGGCG
GCTATTATCGGTGATGAAAGGACTATGTACAATCTCATGAAGAAAGAACTTCGTGAGGTCAAGAAGAAATTTGCAACTCCTCGTTTGAGT
TCTTTAGAAGACACTGCGAAAGCAATTGAGATTGATACAGCTAGTCTTATCGCTGAGGAAGATACCTACGTCAGCGTGACCAAGGCAGGT
TACATCAAGCGTACCAGTCCACGTTCCTTTGCGGCTTCCACCTTGGAAGAAATTGGCAAGCGTGATGATGACCGTTTGATTTTTGTTCAA
TCTGCCAAGACAACCCAGCACCTCTTGATGTTCACAAGTCTTGGAAATGTCATCTACAGACCAATCCATGAGTTGGCAGATATTCGTTGG
AAGGACATCGGAGAGCATCTGAGCCAAACCATCACAAACTTTGAAACGAATGAAGAAATCCTTTATGTGGAAGTACTGGATCAGTTTGAC
GATGCGACAACCTACTTTGCAGTGACTCGCCTTGGTCAAATCAAACGGGTAGAGCGAAAAGAATTCACTCCATGGCGGACCTATAGATCT
AAGTCTGTCAAGTATGCTAAGCTCAAAGACGATACAGATCAGATTGTAGCAGTGGCTCCGATTAAACTAGATGATGTTGTCTTGGTTAGT
CAAAATGGTTATGCCCTGCGTTTCAATATCGAAGAGGTTCCGGTTGTCGGTGCTAAGGCAGCAGGTGTCAAGGCTATGAATTTGAAAGAA
GATGATGTCCTCCAATCTGGCTTTATCTGTAATACTTCGTCCTTCTACCTCTTGACCCAGCGTGGAAGCTTGAAACGTGTTTCCATTGAG
GAAATTCTAGCAACCAGCCGTGCCAAACGAGGATTACAAGTCTTGCGTGAGTTGAAAAACAAACCGCATCGTGTCTTCTTGGCAGGAGCA
GTTGCAGAGCAAGGATTTGTTGGCGATTTCTTCAGTACGGAAGTGGATGTGAACGACCAAACTCTGCTTGTCCAATCCAATAAAGGAACA
ATCTATGAAAGCCGATTGCAAGACTTGAACTTGTCAGAACGCACTAGCAATGGAAGCTTCATTTCTGACACGATTTCAGATGAAGAAGTT
TTTGACGCTTATCTTCAGGAAGTAGTTACTGAAGATAAATAA