Acinetobacter baumannii gyrA conferring resistance to fluoroquinolones

Accession ARO:3003817
DefinitionMutations in the A subunit of DNA gyrase reduce its affinity for fluoroquinolones, thereby conferring resistance.
AMR Gene Familyfluoroquinolone resistant gyrA
Drug Classfluoroquinolone antibiotic, nybomycin
Resistance Mechanismantibiotic target alteration
Classification18 ontology terms | Show
Parent Term(s)14 ontology terms | Show
+ fluoroquinolone resistant gyrA [AMR Gene Family]
+ confers_resistance_to_drug ciprofloxacin [Antibiotic]
+ confers_resistance_to_drug enoxacin [Antibiotic]
+ confers_resistance_to_drug gatifloxacin [Antibiotic]
+ confers_resistance_to_drug grepafloxacin [Antibiotic]
+ confers_resistance_to_drug levofloxacin [Antibiotic]
+ confers_resistance_to_drug lomefloxacin [Antibiotic]
+ confers_resistance_to_drug moxifloxacin [Antibiotic]
+ confers_resistance_to_drug nalidixic acid [Antibiotic]
+ confers_resistance_to_drug norfloxacin [Antibiotic]
+ confers_resistance_to_drug ofloxacin [Antibiotic]
+ confers_resistance_to_drug pefloxacin [Antibiotic]
+ confers_resistance_to_drug sparfloxacin [Antibiotic]
+ confers_resistance_to_drug trovafloxacin [Antibiotic]
Publications

Esterly JS, et al. 2011. Ann Pharmacother 45(2):218-28 Genetic Mechanisms of Antimicrobial Resistance of Acinetobacter baumannii. (PMID 21304033)

Hamouda A, et al. 2004. J. Antimicrob. Chemother. 54(3):695-6 Novel gyrA and parC point mutations in two strains of Acinetobacter baumannii resistant to ciprofloxacin. (PMID 15282231)

Resistomes

Prevalence of Acinetobacter baumannii gyrA conferring resistance to fluoroquinolones among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 1500

PMID: 15282231G81C S83L

>gb|AJF82744.1|-|Acinetobacter baumannii gyrA conferring resistance to fluoroquinolones [Acinetobacter baumannii]
MSVSEIRPIAIEDELKHSYLDYAMSVIVSRALPDVRDGLKPVHRRVLYAMHELGNDYNKA
YKKSARVVGDVIGKYHPHGDSAVYETIVRMAQDFSLRYLLVDGQGNFGSIDGDSAAAMRY
TEVRMTKLAHELLADLEKDTVDWEDNYDGSERIPEVLPTRVPNLLINGAAGIAVGMATNM
APHNMTEVVNACLAYADNPNISIEGLMEYITGPDFPTGGIIYGKSGIVDAYRTGKGRLHI
RGKYHFEEDEKTGRTTIVFTEIPYQVNKARVIERIAELVKEKKLEGISELRDESDKEGMR
IAIDLKRGENAEVVVNNLFLNTQLENSFSINMVCLDNGQPKLMNLKDIIAAFIRHRQEVV
TRRTMFELRKARERGHILEGLTVALANIDEIIETIKTSANPAEARERLLAGEWAGGGVVA
LLEKAGAISVRPDEIEGEDPNRPFGLSDSIYRLSPTQVGAILELRLHRLTGLEQDKLHAE
YTEILGQIAELTAILNDFNLLMGVIREELAQVLQQYGDARRTEIVESRVDFCREDLIPEE
QVVLTVSQTGYAKTQPLSDYQAQRRGGRGKSATSMKDDDFIQHLIVASNHATVLCFTNVG
KVYRLKVFEVPQASRGAKGRPIVNLLPLDATETVTAILPLTEFPENHYVFMATASGTVKR
VELEQFANIRSNGLRAIELNEEDTLIGVAITDGNQQIMLFSNEGKAIRFAETDVRAMGRT
AKGVRGMRVSFASSTLSEEDADVENDDSDDNDDSTDSSLVSRIVSLVVVPETGEVLCASA
NGYGKRTPVNDFPTKKRGGKGVIAIKTSERNGELVGAVSIDETKELLLISDGGTLVRTRA
AEVAMTGRNAQGVRLIRLSEEETLVGVVSIEAVEDEEELLEGEVDTTETDSEEAVSNNED
TSEE



>gb|CP010781.1|-|2990041-2992755|Acinetobacter baumannii gyrA conferring resistance to fluoroquinolones [Acinetobacter baumannii]
ATGAGCGTATCGGAAATCCGACCGATTGCCATTGAGGACGAACTCAAGCATTCATATTTAGATTACGCGATGAGTGTAATTGTATCTCGT
GCATTGCCGGATGTGAGAGACGGTCTTAAACCTGTTCACCGTCGTGTGCTTTATGCCATGCACGAATTGGGCAATGACTATAACAAAGCC
TACAAGAAATCTGCTCGTGTCGTTGGGGACGTAATCGGTAAATATCACCCGCATGGTGACTCAGCTGTTTATGAAACCATTGTTCGTATG
GCTCAAGACTTTAGCTTACGTTATTTATTGGTTGATGGTCAGGGTAACTTCGGTTCGATCGATGGTGATAGCGCTGCGGCAATGCGTTAT
ACCGAAGTCCGTATGACTAAGCTGGCACATGAGCTTCTTGCAGATTTAGAAAAAGACACAGTTGACTGGGAAGATAACTACGACGGTTCG
GAACGTATCCCTGAAGTACTTCCGACACGTGTTCCAAACTTATTAATTAACGGTGCTGCTGGTATTGCTGTAGGTATGGCAACTAACATG
GCACCACACAACATGACAGAAGTTGTGAATGCTTGTTTGGCTTATGCTGACAATCCGAATATCTCGATTGAAGGATTGATGGAATACATT
ACTGGTCCTGACTTCCCTACAGGCGGTATTATTTACGGTAAATCAGGTATTGTTGATGCCTACCGTACCGGTAAAGGTCGTTTACACATT
CGTGGTAAATACCATTTCGAAGAAGATGAAAAGACAGGTCGTACAACCATCGTCTTTACTGAAATTCCATATCAAGTAAACAAAGCAAGA
GTTATTGAACGTATTGCCGAGTTAGTAAAAGAGAAAAAGCTTGAAGGTATTTCAGAACTTCGTGATGAGTCTGATAAAGAAGGTATGCGT
ATTGCAATTGACTTGAAACGCGGTGAAAACGCAGAAGTCGTTGTAAATAACTTATTCTTAAATACCCAGCTTGAAAACTCATTCAGCATC
AACATGGTTTGTCTAGACAATGGACAACCAAAATTGATGAATCTAAAAGATATTATTGCGGCATTTATTCGTCACCGCCAAGAAGTTGTG
ACACGCCGTACCATGTTCGAATTACGTAAAGCACGTGAACGTGGTCATATCTTGGAAGGCTTGACAGTTGCCTTAGCCAATATTGATGAA
ATTATTGAAACCATCAAAACTTCTGCAAACCCTGCTGAAGCGCGTGAGCGTTTACTTGCGGGTGAGTGGGCAGGTGGTGGCGTTGTTGCA
CTACTTGAAAAAGCTGGTGCAATTTCTGTTCGCCCAGATGAAATTGAAGGTGAAGATCCAAATCGTCCATTTGGTTTAAGTGATTCAATT
TATCGTCTGTCACCAACACAAGTAGGCGCAATTTTAGAATTACGTTTACACCGTTTAACTGGTCTTGAACAAGACAAGTTACATGCGGAA
TATACTGAAATTTTAGGTCAAATTGCTGAACTTACTGCAATTTTAAATGACTTTAACTTGTTAATGGGTGTTATTCGCGAAGAGTTGGCA
CAAGTTTTACAACAATATGGCGATGCACGTCGTACCGAAATTGTTGAATCTCGTGTGGATTTCTGCCGTGAAGATTTAATTCCTGAAGAG
CAAGTGGTATTAACGGTTTCGCAAACGGGTTATGCAAAAACTCAACCTCTTTCAGACTATCAGGCACAGCGCCGTGGTGGACGTGGTAAG
TCTGCAACCTCAATGAAAGATGATGACTTTATTCAACATCTGATTGTGGCATCGAACCATGCGACCGTACTTTGCTTTACCAATGTGGGT
AAAGTGTACCGTCTGAAAGTATTTGAAGTTCCTCAAGCATCACGTGGGGCAAAAGGCCGTCCAATCGTGAACTTGTTACCTCTAGATGCA
ACAGAAACCGTAACCGCAATCTTGCCGTTAACCGAGTTCCCGGAAAACCACTATGTGTTTATGGCGACAGCTTCTGGTACGGTTAAGCGT
GTTGAGTTAGAGCAATTTGCAAACATTCGTTCAAATGGTCTACGTGCTATTGAACTTAATGAAGAAGATACTTTAATTGGTGTTGCGATT
ACTGATGGTAATCAGCAAATCATGTTGTTCTCTAACGAAGGTAAGGCAATTCGTTTTGCTGAAACTGACGTACGTGCAATGGGTCGTACA
GCGAAAGGTGTACGCGGTATGCGCGTGAGTTTTGCAAGCAGCACCTTAAGTGAAGAAGATGCAGATGTTGAAAATGATGATTCAGATGAT
AATGATGATTCAACAGATTCAAGTCTAGTAAGTCGCATCGTATCGCTTGTTGTTGTACCTGAGACAGGCGAAGTACTGTGTGCGAGTGCC
AACGGTTATGGTAAACGTACTCCAGTAAATGACTTCCCGACCAAGAAACGTGGTGGTAAGGGTGTTATTGCGATCAAGACAAGTGAACGT
AACGGTGAGCTAGTTGGTGCAGTTTCTATTGATGAAACCAAAGAGTTATTATTAATTTCTGATGGTGGTACGCTTGTTCGTACGCGTGCT
GCAGAAGTTGCAATGACAGGCCGTAATGCTCAAGGTGTTCGTCTGATCCGTTTAAGCGAAGAAGAAACGCTCGTTGGCGTAGTTTCAATT
GAAGCTGTAGAAGACGAAGAAGAACTTCTTGAAGGTGAAGTAGATACGACTGAAACTGATAGCGAAGAAGCTGTATCTAATAATGAAGAT
ACTTCTGAAGAGTAA