Acinetobacter baumannii parC conferring resistance to fluoroquinolones

Accession ARO:3003818
CARD Short NameAbau_parC_FLO
DefinitionMutations in Acinetobacter baumannii parC that result in resistance to fluoroquinolones.
AMR Gene Familyfluoroquinolone resistant parC
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Acinetobacter calcoaceticusg+wgs, Acinetobacter nosocomialisg+wgs, Acinetobacter pittiig+wgs, Escherichia coliwgs, Klebsiella pneumoniaewgs
Classification11 ontology terms | Show
Parent Term(s)14 ontology terms | Show
+ fluoroquinolone resistant parC [AMR Gene Family]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic enoxacin [Antibiotic]
+ confers_resistance_to_antibiotic gatifloxacin [Antibiotic]
+ confers_resistance_to_antibiotic grepafloxacin [Antibiotic]
+ confers_resistance_to_antibiotic levofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic lomefloxacin [Antibiotic]
+ confers_resistance_to_antibiotic moxifloxacin [Antibiotic]
+ confers_resistance_to_antibiotic nalidixic acid [Antibiotic]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic ofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic pefloxacin [Antibiotic]
+ confers_resistance_to_antibiotic sparfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic trovafloxacin [Antibiotic]
Publications

G├╝ler G, et al. 2016. Mikrobiyol Bul 50(2):278-86 [Investigation of fluoroquinolone resistance mechanisms in clinical Acinetobacter baumannii isolates]. (PMID 27175500)

Resistomes

Prevalence of Acinetobacter baumannii parC conferring resistance to fluoroquinolones among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii98.4%0%71.13%0%
Acinetobacter calcoaceticus80%0%73.91%0%
Acinetobacter nosocomialis100%0%77.27%0%
Acinetobacter pittii100%0%81.91%0%
Escherichia coli0%0%0.01%0%
Klebsiella pneumoniae0%0%0.01%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 1400

Legend:

  • discovered in clinical, agricultural, or environmental isolates

  • discovered via laboratory selection experiments

  • ReSeqTB https://platform.reseqtb.org

Published Variants:

PMID in progress (single): S84L V104I D105E


>gb|WP_000202252.1|+|Acinetobacter baumannii parC conferring resistance to fluoroquinolones [Acinetobacter]
MTSLAHHATENRSVAEFTEQAYLNYAMYVIMDRALPHISDGLKPVQRRIVYAMSELGLKS
SGKPKKSARTVGDVLGKYHPHGDLACYEAMVLMAQPFSYRYPLIEGQGNWGSPDDPKSFA
AMRYTEAKLSAYSELLLSELGQGTSEWQDNFDGSLKEPITLPARVPNILLNGTTGIAVGM
ATDIPPHNLREVVKGTIALIRNPQTSDEKLAEYIPAPDLPTKAEIITPPEELLKIQTTGR
GSYRMRAVYTIEKNEIVITELPYQVSGSKVITQIADQMQAKKLPLVVDVRDESDHENPTR
LVIVLRSNRIDAEAVMSHLFATTDLESSYRVNLNMIGEDGRPQVKSIRRILLEWIEIRKK
TVTRRLQYHLNRIEKRLHILAGLLIAYLDIDTVIRIIREEDQPKPVLMEHFNIDEIQAEA
ILELKLRHLAKLEEMEIRHEQDELSAKAAIIREQLENPESLKNLIIGELKEDAKKFGDER
RSPIVARAEAVQIKEQDLMPAETVTVVLSEAGWVRAAKGADVDAENLNYRAGDQYLSHAV
GKTNQRVYFLDETGRSYALPISNLPSARGLGDPLSSKLSPASGVSFIQVYLDDDESELIA
ASSAGYGFKTQTKQLDTNAKAGKTFLTVPDKAKALPLISAQNMTHLAVLSSAGRLLILDL
AELPNLNKGKGNKLIQLEGKEQILSMTTLNLDEIIQVVAGQQHLKLKGDDLQKYMGKRAS
KGQLLPRGYQKANKLLIQR



>gb|NZ_CP009257.1|+|3045127-3047346|Acinetobacter baumannii parC conferring resistance to fluoroquinolones [Acinetobacter]
ATGACCAGCCTTGCGCATCATGCGACAGAAAACCGCTCTGTAGCCGAATTTACTGAACAGGCTTACTTGAATTATGCCATGTACGTCATT
ATGGACCGTGCATTGCCGCATATCAGTGATGGCTTAAAGCCCGTACAGCGCCGTATTGTCTATGCTATGAGCGAGCTAGGCTTAAAAAGC
AGTGGCAAGCCAAAAAAATCAGCGCGTACAGTGGGTGATGTACTTGGTAAATACCACCCACATGGTGACTTGGCATGTTATGAAGCCATG
GTACTCATGGCTCAGCCATTTAGTTACCGCTATCCTTTAATCGAAGGTCAGGGGAACTGGGGTTCACCAGATGATCCTAAATCTTTTGCT
GCGATGCGTTATACCGAAGCCAAACTCTCGGCTTATAGTGAATTATTGCTGAGCGAATTAGGTCAGGGCACTAGCGAATGGCAAGATAAC
TTTGATGGTTCTTTAAAAGAACCGATCACTTTACCTGCACGTGTACCTAATATTCTTCTTAATGGTACGACAGGTATTGCTGTCGGGATG
GCAACTGATATCCCGCCACATAATTTGCGTGAAGTTGTAAAAGGCACAATTGCTTTAATCCGTAATCCGCAAACCTCGGACGAAAAATTA
GCTGAATATATTCCGGCTCCGGATTTACCAACCAAAGCTGAAATTATTACCCCGCCAGAAGAATTACTCAAAATCCAGACCACTGGTCGT
GGTAGTTACCGTATGCGAGCGGTATATACCATTGAGAAAAATGAAATCGTAATTACTGAGCTGCCATATCAAGTCTCTGGTTCTAAGGTA
ATTACTCAAATTGCTGACCAGATGCAGGCTAAAAAGCTGCCATTAGTCGTTGATGTGCGTGATGAATCGGATCATGAAAACCCGACACGA
CTCGTGATTGTACTGCGCTCTAACCGTATTGATGCGGAAGCAGTAATGAGTCACTTATTTGCGACCACCGATTTAGAATCAAGCTATCGT
GTCAATTTAAACATGATTGGCGAAGATGGCCGTCCTCAGGTGAAATCAATTCGTCGTATTTTGCTTGAATGGATCGAGATCCGTAAAAAA
ACGGTAACTCGTCGTTTGCAGTACCATTTAAACCGTATTGAAAAGCGCCTGCATATTTTGGCAGGTCTTTTAATTGCTTATCTCGATATT
GATACAGTCATTCGTATTATTCGTGAAGAAGACCAGCCTAAGCCAGTCTTGATGGAACACTTTAATATTGATGAGATACAGGCCGAGGCG
ATTTTAGAGCTTAAATTACGTCATTTGGCAAAGCTTGAAGAGATGGAAATTCGTCATGAACAAGATGAGCTTTCCGCGAAAGCTGCCATT
ATTCGTGAACAACTCGAAAATCCTGAATCTTTAAAAAATTTGATTATTGGCGAATTAAAAGAAGATGCGAAAAAGTTCGGTGATGAGCGC
CGTTCTCCAATTGTTGCACGTGCTGAAGCGGTTCAAATTAAAGAACAGGATTTAATGCCAGCTGAAACGGTAACAGTCGTGTTGTCTGAA
GCAGGCTGGGTTCGTGCGGCAAAAGGTGCGGATGTGGATGCTGAAAATCTGAACTACCGTGCTGGGGACCAATATTTAAGTCATGCTGTC
GGGAAAACCAATCAGCGAGTTTACTTCCTTGATGAAACAGGGCGCAGCTATGCCTTGCCAATTAGTAACTTACCTTCAGCGAGAGGCTTG
GGGGATCCATTAAGTTCTAAATTATCACCAGCAAGTGGCGTATCGTTTATTCAGGTTTATTTAGATGATGATGAGTCTGAGTTGATTGCT
GCAAGTTCGGCAGGTTATGGTTTTAAAACGCAAACCAAGCAATTAGATACCAATGCGAAAGCCGGTAAGACATTCTTAACGGTTCCGGAT
AAGGCAAAGGCTTTACCACTTATTTCTGCCCAAAACATGACGCATTTGGCTGTACTGAGCTCAGCAGGGCGTTTGTTAATTTTAGATTTG
GCAGAACTACCAAATTTAAATAAAGGTAAAGGTAATAAGTTGATACAACTTGAAGGCAAAGAGCAAATTTTATCCATGACAACCCTGAAC
TTAGATGAAATAATTCAGGTGGTTGCAGGTCAACAACATCTCAAATTAAAAGGTGATGATCTACAAAAATACATGGGTAAACGTGCTTCG
AAAGGTCAGCTCTTACCACGTGGATATCAAAAAGCAAATAAACTGTTGATTCAGAGATAA