oqxA

Download Sequences

Ontology	CARD's Antibiotic Resistance Ontology
Accession	ARO:3003922
CARD Short Name	oqxA
Definition	RND efflux pump conferring resistance to fluoroquinolone.
AMR Gene Family	resistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Class	tetracycline antibiotic, nitrofuran antibiotic, diaminopyrimidine antibiotic, glycylcycline, fluoroquinolone antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Citrobacter freundii^wgs, Enterobacter hormaechei^p+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^wgs, Klebsiella aerogenes^g, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^wgs, Salmonella enterica^g+p+wgs, Shigella dysenteriae^g, Shigella flexneri^p+wgs, Shigella sonnei^wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^g+wgs, Citrobacter freundii^wgs, Enterobacter asburiae^g+wgs, Enterobacter cancerogenus^wgs, Enterobacter chengduensis^g+wgs, Enterobacter cloacae^g+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^g+wgs, Escherichia albertii^p+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^g+wgs, Klebsiella michiganensis^g+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^g+wgs, Kosakonia arachidis^g+wgs, Leclercia adecarboxylata^wgs, Salmonella enterica^g+p+wgs, Shigella dysenteriae^g, Shigella flexneri^p+wgs, Shigella sonnei^wgs
Classification	16 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + tetracycline antibiotic [Drug Class] + determinant of antibiotic resistance + antibiotic efflux [Resistance Mechanism] + nitrofuran antibiotic [Drug Class] + diaminopyrimidine antibiotic [Drug Class] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + glycylcycline [Drug Class] + fluoroquinolone antibiotic [Drug Class] + trimethoprim [Antibiotic] + resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family] + nitrofurantoin [Antibiotic] + ciprofloxacin [Antibiotic] + tigecycline [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + subunit of efflux pump conferring antibiotic resistance + part_of oqxAB
Publications	Kim HB, et al. 2009. Antimicrob. Agents Chemother. 53(8):3582-4 oqxAB encoding a multidrug efflux pump in human clinical isolates of Enterobacteriaceae. (PMID 19528276)

Resistomes

Prevalence of oqxA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	0%	0%	0%	0%	0%
Citrobacter amalonaticus	90.91%	0%	80%	0%	0%
Citrobacter freundii	0%	0%	0.19%	0%	0%
Citrobacter freundii	0%	0%	0.19%	0%	0%
Enterobacter asburiae	0%	0%	0%	0%	0%
Enterobacter asburiae	83.87%	0%	97.23%	0%	0%
Enterobacter cancerogenus	0%	0%	14.29%	0%	0%
Enterobacter cancerogenus	0%	0%	0%	0%	0%
Enterobacter chengduensis	100%	0%	100%	0%	0%
Enterobacter chengduensis	0%	0%	0%	0%	0%
Enterobacter cloacae	0%	0%	0%	0%	0%
Enterobacter cloacae	91.07%	0%	91.05%	0%	0%
Enterobacter hormaechei	93.17%	0.06%	93.48%	0%	0%
Enterobacter hormaechei	0%	0.06%	0.26%	0%	0%
Enterobacter kobei	100%	0%	97.82%	0%	0%
Enterobacter kobei	0%	0%	0%	0%	0%
Enterobacter roggenkampii	83.72%	0%	88.85%	0%	0%
Enterobacter roggenkampii	0%	0%	0%	0%	0%
Escherichia albertii	0%	0.56%	2.58%	0%	0%
Escherichia albertii	0%	0%	0%	0%	0%
Escherichia coli	0.1%	0.68%	3.62%	0%	0%
Escherichia coli	0.07%	0.4%	2.44%	0%	0%
Escherichia fergusonii	0%	0%	1.09%	0%	0%
Escherichia fergusonii	0%	0.36%	7.61%	0%	0%
Klebsiella aerogenes	2%	0%	0%	0%	0%
Klebsiella aerogenes	98%	0%	99.44%	0%	0%
Klebsiella michiganensis	0%	0%	0%	0%	0%
Klebsiella michiganensis	96.77%	0%	94.95%	0%	0%
Klebsiella oxytoca	100%	0%	94.12%	0%	0%
Klebsiella oxytoca	0%	0%	0%	0%	0%
Klebsiella pneumoniae	67.4%	0.02%	74.03%	0%	0%
Klebsiella pneumoniae	84.2%	0.06%	89.77%	0%	0%
Klebsiella quasipneumoniae	92.44%	0%	90.13%	0%	0%
Klebsiella quasipneumoniae	0%	0%	5%	0%	0%
Kosakonia arachidis	0%	0%	0%	0%	0%
Kosakonia arachidis	100%	0%	100%	0%	0%
Leclercia adecarboxylata	0%	0%	0%	0%	0%
Leclercia adecarboxylata	0%	0%	2.33%	0%	0%
Salmonella enterica	0.57%	2.08%	1.73%	0%	0%
Salmonella enterica	0.69%	3.56%	1.84%	0%	0%
Shigella dysenteriae	14.29%	0%	0%	0%	0%
Shigella dysenteriae	14.29%	0%	0%	0%	0%
Shigella flexneri	0%	2.41%	0.31%	0%	0%
Shigella flexneri	0%	2.41%	0.31%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 670

Protein
DNA

>gb|AAP43109.1|+|oqxA [Escherichia coli]
MSLQKTWGNIHLTALGAMMLSFLLVGCDDSVAQNAAPPAPTVSAAKVLVKSISQWDSFNGRIEAVESVQLRPRVSGYIDKVNYTDGQEVK
KGQVLFTIDDRTYRAALEQAQAALARAKTQASLAQSEANRTDKLVHTNLVSREEWEQRRSAAVQAQADIRAAQAAVDAAQLNLDFTKVTA
PIDGRASRALITSGNLVTAGDTASVLTTLVSQKTVYVYFDVDESTYLHYQNLARRGQGASSDNQALPVEIGLVGEEGYPHQGKVDFLDNQ
LTPSTGTIRMRALLDNSQRLFTPGLFARVRLPGSAEFKATLIDDKAVLTDQDRKYVYIVDKDGKAQRRDITPGRLADGLRIVQKGLNPGD
SVIVDGLQKVFMPGMPVNAKTVAMTSSATLN

>gb|EU370913.1|+|46652-47827|oqxA [Escherichia coli]
ATGAGCCTGCAAAAAACCTGGGGAAACATTCACCTGACCGCGCTCGGCGCGATGATGCTCTCCTTTCTGCTCGTCGGCTGCGACGACAGC
GTCGCACAGAATGCTGCGCCTCCCGCCCCGACGGTCAGCGCCGCTAAGGTGCTGGTGAAGTCGATCAGTCAGTGGGATAGTTTTAACGGT
CGCATTGAAGCGGTGGAGAGCGTTCAGCTTCGCCCTCGCGTCTCGGGATACATTGATAAAGTGAATTACACTGACGGCCAGGAGGTGAAA
AAGGGCCAGGTGCTGTTCACGATAGATGACAGAACCTATCGCGCCGCGCTGGAGCAGGCGCAGGCGGCGTTGGCAAGAGCCAAAACGCAG
GCCAGCCTCGCGCAAAGCGAGGCGAACCGCACCGATAAATTAGTCCATACCAACCTCGTCTCCCGTGAAGAGTGGGAGCAGCGCCGGTCA
GCCGCGGTTCAGGCGCAGGCCGACATTCGCGCCGCGCAGGCGGCGGTGGATGCCGCGCAGCTTAACCTCGACTTCACCAAAGTGACCGCC
CCTATTGACGGCCGCGCCAGCCGGGCGCTGATCACCAGCGGTAACCTGGTCACCGCGGGCGACACCGCCAGCGTGCTCACCACCCTGGTC
TCGCAAAAGACGGTGTACGTCTACTTTGACGTCGACGAGTCAACCTACCTCCACTATCAAAACCTCGCCCGCCGCGGGCAAGGCGCGTCC
AGCGATAATCAGGCGCTCCCGGTGGAGATTGGCCTGGTGGGCGAGGAGGGTTACCCCCACCAGGGCAAAGTGGATTTTCTCGATAATCAG
TTAACGCCGAGTACCGGCACCATCCGCATGCGTGCGCTGCTGGATAACTCGCAGCGTCTGTTCACGCCGGGGCTGTTTGCCCGCGTGCGT
CTGCCGGGCAGCGCAGAGTTCAAAGCCACGCTGATCGACGACAAAGCGGTACTGACCGATCAGGATCGTAAATACGTCTATATCGTTGAT
AAAGATGGTAAAGCACAGCGCCGCGACATTACCCCAGGGCGGCTGGCAGACGGTTTACGCATCGTTCAGAAGGGGTTGAATCCTGGGGAT
AGCGTCATCGTCGACGGCTTACAAAAAGTGTTTATGCCGGGTATGCCGGTTAACGCCAAAACCGTTGCCATGACCTCCAGCGCCACCCTT
AACTGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

oqxA

Prevalence: protein homolog model (view sequences)

Graph