oqxA

Download Sequences

Accession	ARO:3003922
CARD Short Name	oqxA
Definition	RND efflux pump conferring resistance to fluoroquinolone.
AMR Gene Family	resistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Class	tetracycline antibiotic, diaminopyrimidine antibiotic, glycylcycline, fluoroquinolone antibiotic, nitrofuran antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Citrobacter freundii^wgs, Enterobacter hormaechei^p+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^wgs, Klebsiella aerogenes^g, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^wgs, Salmonella enterica^g+p+wgs, Shigella sonnei^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^p+wgs, Bacillus subtilis^wgs, Citrobacter amalonaticus^g+wgs, Citrobacter freundii^wgs, Enterobacter asburiae^g+wgs, Enterobacter chengduensis^g+wgs, Enterobacter cloacae^g+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^g+wgs, Enterobacter roggenkampii^g+wgs, Escherichia albertii^p+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^p+wgs, Klebsiella aerogenes^g+wgs, Klebsiella michiganensis^g+wgs, Klebsiella oxytoca^g+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^g+wgs, Kosakonia arachidis^g+wgs, Salmonella enterica^g+p+wgs, Shigella sonnei^wgs
Classification	16 ontology terms \| Show + process or component of antibiotic biology or chemistry + antibiotic molecule + mechanism of antibiotic resistance + tetracycline antibiotic [Drug Class] + antibiotic efflux [Resistance Mechanism] + determinant of antibiotic resistance + diaminopyrimidine antibiotic [Drug Class] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + glycylcycline [Drug Class] + fluoroquinolone antibiotic [Drug Class] + nitrofuran antibiotic [Drug Class] + nitrofurantoin [Antibiotic] + trimethoprim [Antibiotic] + ciprofloxacin [Antibiotic] + resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family] + tigecycline [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + subunit of efflux pump conferring antibiotic resistance + part_of oqxAB
Publications	Kim HB, et al. 2009. Antimicrob. Agents Chemother. 53(8):3582-4 oqxAB encoding a multidrug efflux pump in human clinical isolates of Enterobacteriaceae. (PMID 19528276)

Resistomes

Prevalence of oqxA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Acinetobacter baumannii	0%	0%	0%	0%
Acinetobacter baumannii	0%	0.06%	0.06%	0%
Bacillus subtilis	0%	0%	0%	0%
Bacillus subtilis	0%	0%	0.34%	0%
Citrobacter amalonaticus	0%	0%	0%	0%
Citrobacter amalonaticus	90%	0%	72.92%	0%
Citrobacter freundii	0%	0%	0.25%	0%
Citrobacter freundii	0%	0%	0.25%	0%
Enterobacter asburiae	0%	0%	0%	0%
Enterobacter asburiae	85.71%	0%	84.72%	0%
Enterobacter chengduensis	0%	0%	0%	0%
Enterobacter chengduensis	100%	0%	90.91%	0%
Enterobacter cloacae	0%	0%	0%	0%
Enterobacter cloacae	93.18%	0%	74.55%	0%
Enterobacter hormaechei	0%	0.17%	0.06%	0%
Enterobacter hormaechei	92.26%	0.17%	74.69%	0%
Enterobacter kobei	0%	0%	0%	0%
Enterobacter kobei	91.67%	0%	84.43%	0%
Enterobacter roggenkampii	0%	0%	0%	0%
Enterobacter roggenkampii	76.92%	0%	66.06%	0%
Escherichia albertii	0%	0%	0%	0%
Escherichia albertii	0%	2.63%	1.15%	0%
Escherichia coli	0.09%	0.33%	1.8%	0%
Escherichia coli	0.09%	0.57%	2.83%	0%
Escherichia fergusonii	0%	0%	1.54%	0%
Escherichia fergusonii	0%	0.4%	6.15%	0%
Klebsiella aerogenes	2.5%	0%	0%	0%
Klebsiella aerogenes	100%	0%	80.82%	0%
Klebsiella michiganensis	0%	0%	0%	0%
Klebsiella michiganensis	93.02%	0%	72.08%	0%
Klebsiella oxytoca	0%	0%	0%	0%
Klebsiella oxytoca	100%	0%	78.8%	0%
Klebsiella pneumoniae	68.67%	0.02%	55.37%	0%
Klebsiella pneumoniae	87.24%	0.07%	67.12%	0%
Klebsiella quasipneumoniae	92.86%	0%	70.61%	0%
Klebsiella quasipneumoniae	0%	0%	6.81%	0%
Kosakonia arachidis	100%	0%	100%	0%
Kosakonia arachidis	0%	0%	0%	0%
Salmonella enterica	0.46%	1.39%	0.98%	0%
Salmonella enterica	0.46%	2.49%	1.05%	0%
Shigella sonnei	0%	0%	0.07%	0%
Shigella sonnei	0%	0%	0.07%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 670

Protein
DNA

>gb|AAP43109.1|+|oqxA [Escherichia coli]
MSLQKTWGNIHLTALGAMMLSFLLVGCDDSVAQNAAPPAPTVSAAKVLVKSISQWDSFNGRIEAVESVQLRPRVSGYIDKVNYTDGQEVK
KGQVLFTIDDRTYRAALEQAQAALARAKTQASLAQSEANRTDKLVHTNLVSREEWEQRRSAAVQAQADIRAAQAAVDAAQLNLDFTKVTA
PIDGRASRALITSGNLVTAGDTASVLTTLVSQKTVYVYFDVDESTYLHYQNLARRGQGASSDNQALPVEIGLVGEEGYPHQGKVDFLDNQ
LTPSTGTIRMRALLDNSQRLFTPGLFARVRLPGSAEFKATLIDDKAVLTDQDRKYVYIVDKDGKAQRRDITPGRLADGLRIVQKGLNPGD
SVIVDGLQKVFMPGMPVNAKTVAMTSSATLN

>gb|EU370913.1|+|46652-47827|oqxA [Escherichia coli]
ATGAGCCTGCAAAAAACCTGGGGAAACATTCACCTGACCGCGCTCGGCGCGATGATGCTCTCCTTTCTGCTCGTCGGCTGCGACGACAGC
GTCGCACAGAATGCTGCGCCTCCCGCCCCGACGGTCAGCGCCGCTAAGGTGCTGGTGAAGTCGATCAGTCAGTGGGATAGTTTTAACGGT
CGCATTGAAGCGGTGGAGAGCGTTCAGCTTCGCCCTCGCGTCTCGGGATACATTGATAAAGTGAATTACACTGACGGCCAGGAGGTGAAA
AAGGGCCAGGTGCTGTTCACGATAGATGACAGAACCTATCGCGCCGCGCTGGAGCAGGCGCAGGCGGCGTTGGCAAGAGCCAAAACGCAG
GCCAGCCTCGCGCAAAGCGAGGCGAACCGCACCGATAAATTAGTCCATACCAACCTCGTCTCCCGTGAAGAGTGGGAGCAGCGCCGGTCA
GCCGCGGTTCAGGCGCAGGCCGACATTCGCGCCGCGCAGGCGGCGGTGGATGCCGCGCAGCTTAACCTCGACTTCACCAAAGTGACCGCC
CCTATTGACGGCCGCGCCAGCCGGGCGCTGATCACCAGCGGTAACCTGGTCACCGCGGGCGACACCGCCAGCGTGCTCACCACCCTGGTC
TCGCAAAAGACGGTGTACGTCTACTTTGACGTCGACGAGTCAACCTACCTCCACTATCAAAACCTCGCCCGCCGCGGGCAAGGCGCGTCC
AGCGATAATCAGGCGCTCCCGGTGGAGATTGGCCTGGTGGGCGAGGAGGGTTACCCCCACCAGGGCAAAGTGGATTTTCTCGATAATCAG
TTAACGCCGAGTACCGGCACCATCCGCATGCGTGCGCTGCTGGATAACTCGCAGCGTCTGTTCACGCCGGGGCTGTTTGCCCGCGTGCGT
CTGCCGGGCAGCGCAGAGTTCAAAGCCACGCTGATCGACGACAAAGCGGTACTGACCGATCAGGATCGTAAATACGTCTATATCGTTGAT
AAAGATGGTAAAGCACAGCGCCGCGACATTACCCCAGGGCGGCTGGCAGACGGTTTACGCATCGTTCAGAAGGGGTTGAATCCTGGGGAT
AGCGTCATCGTCGACGGCTTACAAAAAGTGTTTATGCCGGGTATGCCGGTTAACGCCAAAACCGTTGCCATGACCTCCAGCGCCACCCTT
AACTGA

oqxA

Prevalence: protein homolog model (view sequences)

Graph