oqxA

Accession ARO:3003922
DefinitionRND efflux pump conferring resistance to fluoroquinolone
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump
Drug Classtetracycline antibiotic, phenicol antibiotic, nitrofuran antibiotic, triclosan, diaminopyrimidine antibiotic, penam, fluoroquinolone antibiotic, acridine dye, carbapenem, aminoglycoside antibiotic, monobactam, antibacterial free fatty acids, glycylcycline, macrolide antibiotic, aminocoumarin antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesCitrobacter freundiiwgs, Enterobacter cloacaewgs, Enterobacter hormaecheip, Escherichia colip+wgs, Klebsiella oxytocawgs, Salmonella entericap+wgs, Shigella flexneriwgs, Shigella sonneiwgs
Classification28 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Kim HB, et al. 2009. Antimicrob. Agents Chemother. 53(8):3582-4 oqxAB encoding a multidrug efflux pump in human clinical isolates of Enterobacteriaceae. (PMID 19528276)

Resistomes

Prevalence of oqxA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.11%
Citrobacter amalonaticus66.67%0%77.78%
Citrobacter freundii0%0%0.78%
Enterobacter asburiae80%0%96.88%
Enterobacter cloacae96.67%0%90.74%
Enterobacter hormaechei91.89%0.9%91.44%
Enterobacter kobei100%0%95.31%
Enterococcus faecium0%0%0%
Escherichia coli0%0.48%1.16%
Klebsiella oxytoca100%0%91.59%
Klebsiella pneumoniae0%0%0%
Pseudomonas aeruginosa0%0%0%
Salmonella enterica0%0.7%0.18%
Shigella flexneri0%0%0.26%
Shigella sonnei0%0%0.08%
Vibrio parahaemolyticus0%0%0.17%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 670


>gb|AAP43109.1|+|oqxA [Escherichia coli]
MSLQKTWGNIHLTALGAMMLSFLLVGCDDSVAQNAAPPAPTVSAAKVLVKSISQWDSFNGRIEAVESVQLRPRVSGYIDKVNYTDGQEVK
KGQVLFTIDDRTYRAALEQAQAALARAKTQASLAQSEANRTDKLVHTNLVSREEWEQRRSAAVQAQADIRAAQAAVDAAQLNLDFTKVTA
PIDGRASRALITSGNLVTAGDTASVLTTLVSQKTVYVYFDVDESTYLHYQNLARRGQGASSDNQALPVEIGLVGEEGYPHQGKVDFLDNQ
LTPSTGTIRMRALLDNSQRLFTPGLFARVRLPGSAEFKATLIDDKAVLTDQDRKYVYIVDKDGKAQRRDITPGRLADGLRIVQKGLNPGD
SVIVDGLQKVFMPGMPVNAKTVAMTSSATLN


>gb|EU370913.1|+|46652-47827|oqxA [Escherichia coli]
ATGAGCCTGCAAAAAACCTGGGGAAACATTCACCTGACCGCGCTCGGCGCGATGATGCTCTCCTTTCTGCTCGTCGGCTGCGACGACAGC
GTCGCACAGAATGCTGCGCCTCCCGCCCCGACGGTCAGCGCCGCTAAGGTGCTGGTGAAGTCGATCAGTCAGTGGGATAGTTTTAACGGT
CGCATTGAAGCGGTGGAGAGCGTTCAGCTTCGCCCTCGCGTCTCGGGATACATTGATAAAGTGAATTACACTGACGGCCAGGAGGTGAAA
AAGGGCCAGGTGCTGTTCACGATAGATGACAGAACCTATCGCGCCGCGCTGGAGCAGGCGCAGGCGGCGTTGGCAAGAGCCAAAACGCAG
GCCAGCCTCGCGCAAAGCGAGGCGAACCGCACCGATAAATTAGTCCATACCAACCTCGTCTCCCGTGAAGAGTGGGAGCAGCGCCGGTCA
GCCGCGGTTCAGGCGCAGGCCGACATTCGCGCCGCGCAGGCGGCGGTGGATGCCGCGCAGCTTAACCTCGACTTCACCAAAGTGACCGCC
CCTATTGACGGCCGCGCCAGCCGGGCGCTGATCACCAGCGGTAACCTGGTCACCGCGGGCGACACCGCCAGCGTGCTCACCACCCTGGTC
TCGCAAAAGACGGTGTACGTCTACTTTGACGTCGACGAGTCAACCTACCTCCACTATCAAAACCTCGCCCGCCGCGGGCAAGGCGCGTCC
AGCGATAATCAGGCGCTCCCGGTGGAGATTGGCCTGGTGGGCGAGGAGGGTTACCCCCACCAGGGCAAAGTGGATTTTCTCGATAATCAG
TTAACGCCGAGTACCGGCACCATCCGCATGCGTGCGCTGCTGGATAACTCGCAGCGTCTGTTCACGCCGGGGCTGTTTGCCCGCGTGCGT
CTGCCGGGCAGCGCAGAGTTCAAAGCCACGCTGATCGACGACAAAGCGGTACTGACCGATCAGGATCGTAAATACGTCTATATCGTTGAT
AAAGATGGTAAAGCACAGCGCCGCGACATTACCCCAGGGCGGCTGGCAGACGGTTTACGCATCGTTCAGAAGGGGTTGAATCCTGGGGAT
AGCGTCATCGTCGACGGCTTACAAAAAGTGTTTATGCCGGGTATGCCGGTTAACGCCAAAACCGTTGCCATGACCTCCAGCGCCACCCTT
AACTGA