poxtA

Accession ARO:3004470
DefinitionPoxtA is an ABC-F subfamily ATP-binding cassette protein that confers resistance to tetracycline, -phenicol, and oxazolidinone via modification of the bacterial ribosome. The encoding gene was isolated from a methicillin-resistant Staphylococcus aureus strain.
AMR Gene FamilyABC-F ATP-binding cassette ribosomal protection protein
Drug Classphenicol antibiotic, lincosamide antibiotic, macrolide antibiotic, streptogramin antibiotic, oxazolidinone antibiotic, tetracycline antibiotic, pleuromutilin antibiotic
Resistance Mechanismantibiotic target protection
ResistomesEnterococcus faecaliswgs, Enterococcus faeciumwgs, Staphylococcus aureuswgs
Classification13 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic doxycycline [Antibiotic]
+ confers_resistance_to_antibiotic linezolid [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ confers_resistance_to_antibiotic florfenicol [Antibiotic]
+ ABC-F ATP-binding cassette ribosomal protection protein [AMR Gene Family]
Publications

Antonelli A, et al. 2018. J. Antimicrob. Chemother. : Characterization of poxtA, a novel phenicol-oxazolidinone-tetracycline resistance gene from an MRSA of clinical origin. (PMID 29635422)

Resistomes

Prevalence of poxtA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis0%0.88%0.26%
Enterococcus faecium0%0%3.18%
Staphylococcus aureus0%0%0.01%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|AVI44920.1|-|poxtA [Staphylococcus aureus]
MKGKNMNLAFGLEEIYEDAEFQIGDLDKVGIVGVNGAGKTTLFRLLLGELELDNGSLTSGNARIGYLPQEIVLEDEDITVWDFLFEGRPI
KKYEQELEEIYKKLETAVNAEQEALLARMGTLQERLEYFDFYEAETILLEFADKMSIDAELYHRPMRELSGGQKSKMAFARLLYSKPEIL
LLDEPTNHLDVSTKDFVIKYLKNYRGSVLIISHDIDFLNRIINKIMYINKATHKISVYDGDYYIYKKKYAEEQRIREMAIVQQEKEIKEL
SDFVQKAKQASQTNHHLKRMGQERALRLDKKRGELQKRNRLYKRVKMDIRPKREGAQVPLEVENITFHYSGYPTLYQNLSFQINGRERFL
VVGENGVGKSTLLKLMMGILSPDEGCIRFNQKTDIAYYAQELEQLDENKTVIDNVESEGYTPWQIRAVLSNFLFYDDDVNKKVSVLSPGE
KARVALCKILLQKANLLILDEPTNHLDPETQKIIGGNFNLFEGTIIAVSHNPSFVEQIGISRMLILPSGRIEPYSRELLEYYYEINGSVA
KF


>gb|MF095097.1|-|1856-3484|poxtA [Staphylococcus aureus]
ATGAAAGGTAAAAATATGAATTTAGCCTTTGGGTTGGAAGAAATTTATGAGGATGCTGAGTTTCAAATCGGAGATTTGGATAAGGTCGGT
ATTGTCGGCGTGAACGGAGCCGGAAAGACCACCTTGTTCCGCCTGCTGTTGGGAGAACTTGAACTTGATAATGGTTCACTGACCAGTGGA
AATGCCCGTATTGGTTATCTCCCACAGGAAATTGTCTTGGAAGATGAGGATATTACCGTTTGGGATTTCCTTTTTGAGGGACGTCCGATT
AAAAAGTATGAGCAGGAATTGGAAGAAATCTATAAAAAGCTTGAAACCGCAGTCAATGCAGAGCAGGAAGCACTGCTTGCCCGAATGGGA
ACATTGCAAGAACGCTTGGAGTATTTCGACTTCTATGAGGCAGAAACAATTCTGTTGGAGTTTGCAGATAAAATGAGCATTGATGCAGAA
TTATATCATCGTCCGATGAGAGAGCTTTCAGGCGGACAAAAATCCAAAATGGCATTTGCCAGACTACTATATTCAAAACCGGAAATTCTA
TTGTTGGATGAGCCTACCAACCATTTAGATGTCAGCACAAAGGATTTTGTTATAAAATACTTAAAGAATTATAGGGGTTCGGTACTGATT
ATCAGCCATGATATTGATTTTCTAAATCGGATTATCAACAAAATTATGTACATCAACAAAGCTACCCATAAAATATCTGTTTATGATGGA
GACTACTACATCTACAAGAAAAAGTATGCAGAGGAACAGCGGATTCGTGAAATGGCGATTGTACAGCAGGAAAAAGAAATAAAGGAGCTT
TCCGATTTTGTACAAAAAGCAAAACAAGCCAGTCAGACCAATCATCACCTCAAACGAATGGGTCAAGAGCGAGCCTTGCGGCTTGATAAA
AAGCGTGGAGAGCTGCAAAAGAGAAATCGACTGTACAAGCGTGTGAAGATGGATATTCGCCCCAAGCGTGAAGGGGCACAAGTTCCCTTA
GAGGTGGAAAATATCACCTTCCACTATTCGGGGTATCCCACCCTTTATCAGAACCTTTCCTTTCAGATTAACGGAAGAGAACGATTTCTT
GTGGTGGGTGAAAACGGTGTCGGTAAATCCACCTTATTGAAATTGATGATGGGTATTCTCAGTCCAGATGAAGGATGCATTCGCTTTAAC
CAGAAAACTGATATTGCATATTATGCACAGGAACTCGAACAGCTTGATGAAAACAAAACGGTCATTGACAATGTGGAGTCTGAAGGATAT
ACACCGTGGCAAATCAGAGCCGTACTGAGCAACTTCCTGTTTTATGATGACGATGTAAACAAGAAAGTATCTGTGCTGTCCCCTGGAGAA
AAAGCAAGGGTTGCCCTTTGCAAAATCCTATTACAGAAAGCCAATCTTTTGATACTGGACGAGCCGACCAACCACCTTGACCCAGAAACG
CAGAAAATCATTGGCGGCAACTTCAATTTGTTTGAGGGAACCATTATTGCCGTTAGCCATAACCCATCCTTTGTGGAACAAATCGGAATT
AGCCGTATGCTTATTTTGCCCAGCGGTCGAATTGAACCCTATTCCCGTGAGCTGCTTGAGTATTATTATGAAATCAACGGTTCTGTTGCA
AAGTTTTAA