MCR-3.7

Accession ARO:3004510
DefinitionAn MCR polymyxin (colistin) resistance gene variant identified in Aeromonas
AMR Gene FamilyMCR phosphoethanolamine transferase
Drug Classpeptide antibiotic
Resistance Mechanismantibiotic target alteration
Classification15 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ evolutionary_variant_of MCR-3.1
+ MCR phosphoethanolamine transferase [AMR Gene Family]
Publications

Eichhorn I, et al. 2018. J. Antimicrob. Chemother. 73(5):1217-1221 Identification of novel variants of the colistin resistance gene mcr-3 in Aeromonas spp. from the national resistance monitoring programme GERM-Vet and from diagnostic submissions. (PMID 29394397)

Resistomes

Prevalence of MCR-3.7 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1000


>gb|AST36141.1|+|MCR-3.7 [Aeromonas media]
MPSLIKIKIVPLIFFLALYFAFMLNWRGVLHFYEILYKLEDFKFGFAISLPILLVAALNFAFVPFSIRYLVKPFFALLIALSAIVSYTMM
KYRVLFDQNMIQNIFETNQNEALAYLSLPIIGWVTIVGFIPAILLFFVEIEYEEKWFKGILTRVLSMFASLIVIAVIAALYYQDYVSVGR
NNSNLQREIVPANFVNSTVKYVYNRYLAEPIPFTTLGDDAKRDTNKSKPTLMFLVVGETARGKNFSMNGYEKDTNPFTSKSGGVISFNDV
RSCGTATAVSVPCMFSNMGRKEFDDNLARNSEGLLDVLQKTGVSIFWKENDGGCKGVCDRVPNIEVKPKDYPKFCDKNTCYDEVVLQDLD
SEIAQMKGDKLVGFHLIGSHGPTYYKRYPDAHRQFTPDCPRSDIENCTDEELTNTYDNTIRYTDFVIAEMIAKLKTYEDKYNTALLYVSD
HGESLGAMGLYLHGTPYKFAPDDQTRVPMQVWMSPGFTKEKGMNMECLQQKAADTRYSHDNIFSSVLGIWDVKTSVYEKGLDIFSQCRNV
Q


>gb|MF598077.1|+|94-1719|MCR-3.7 [Aeromonas media]
ATGCCTTCCCTTATAAAAATAAAAATTGTGCCGCTCATATTTTTTTTGGCACTGTATTTTGCATTTATGCTGAACTGGCGTGGAGTTCTC
CATTTTTACGAAATTCTTTATAAATTAGAAGATTTTAAATTTGGTTTCGCCATTTCATTACCAATATTGCTTGTTGCAGCGCTTAATTTT
GCATTTGTTCCATTTTCGATACGGTATTTAGTAAAGCCTTTTTTTGCACTTCTTATCGCACTTAGCGCAATCGTTAGTTACACAATGATG
AAGTATAGAGTCTTGTTTGATCAAAACATGATTCAGAATATTTTTGAAACCAATCAAAATGAGGCATTAGCATATTTAAGTTTGCCAATT
ATAGGATGGGTTACTATTGTTGGATTTATCCCTGCCATTTTACTTTTCTTTGTTGAAATTGAATATGAGGAAAAATGGTTTAAAGGGATT
CTAACTCGCGTCCTATCGATGTTTGCATCCCTTATAGTGATTGCGGTTATTGCAGCACTATACTATCAAGATTATGTTTCAGTGGGGCGC
AACAATTCAAACCTCCAGCGTGAAATTGTTCCGGCCAATTTTGTTAATAGTACCGTTAAATATGTTTATAATCGTTATCTTGCAGAACCA
ATCCCATTTACTACTTTAGGTGATGATGCAAAACGGGATACTAATAAAAGTAAGCCCACGTTGATGTTCCTGGTCGTTGGTGAAACTGCT
CGTGGTAAAAATTTCTCGATGAATGGCTATGAGAAAGATACCAACCCATTTACCAGTAAATCTGGTGGTGTGATCTCCTTTAATGATGTT
CGTTCGTGTGGGACAGCAACCGCTGTATCTGTCCCCTGCATGTTCTCCAATATGGGGAGAAAGGAGTTTGATGATAATCTCGCTCGTAAT
AGCGAGGGTTTGTTAGATGTGTTGCAGAAAACGGGGGTCTCCATTTTTTGGAAGGAGAACGATGGCGGCTGCAAAGGCGTCTGCGACCGA
GTACCTAACATCGAGGTCAAACCGAAGGATTACCCAAAGTTCTGCGATAAAAATACATGCTATGACGAGGTTGTCCTTCAAGACCTCGAT
AGTGAAATTGCTCAAATGAAAGGGGATAAGCTGGTTGGCTTCCACCTGATAGGTAGCCATGGCCCAACCTACTACAAGCGCTATCCTGAT
GCTCATCGTCAGTTCACCCCTGACTGTCCACGCAGTGATATTGAAAACTGCACAGATGAAGAGCTCACCAACACCTATGACAACACCATC
CGCTACACGGATTTCGTGATTGCAGAGATGATTGCCAAGTTGAAAACCTACGAAGATAAGTACAACACCGCGTTGCTCTACGTCTCCGAT
CATGGTGAATCACTGGGAGCTATGGGGCTTTACCTGCACGGTACACCGTACAAGTTTGCACCGGATGATCAGACCCGCGTACCTATGCAG
GTGTGGATGTCACCTGGATTTACCAAAGAGAAAGGCATGAATATGGAATGTTTGCAGCAGAAAGCCGCTGATACTCGTTACTCACACGAT
AATATTTTCTCATCTGTATTGGGTATCTGGGACGTCAAAACATCAGTTTACGAAAAGGGTCTAGATATTTTCAGTCAATGTCGTAATGTT
CAATAA