cfr(B)

Accession ARO:3004649
Definitioncfr(B) has been observed in mobile genetic elements in E. faecium and Clostridioides difficile and confers resistance to linezolid, clindamycin, erythromycin, chloramphenicol, and retapamulin.
AMR Gene FamilyCfr 23S ribosomal RNA methyltransferase
Drug Classoxazolidinone antibiotic, macrolide antibiotic, streptogramin antibiotic, lincosamide antibiotic, phenicol antibiotic
Resistance Mechanismantibiotic target alteration
ResistomesEnterococcus faecaliswgs, Enterococcus faeciumwgs
Classification22 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic linezolid [Antibiotic]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
+ cfr(B) Group
Publications

Deshpande LM, et al. 2015. Antimicrob. Agents Chemother. 59(10):6256-61 Detection of a New cfr-Like Gene, cfr(B), in Enterococcus faecium Isolates Recovered from Human Specimens in the United States as Part of the SENTRY Antimicrobial Surveillance Program. (PMID 26248384)

Resistomes

Prevalence of cfr(B) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis0%0%0.39%
Enterococcus faecium0%0%0.07%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 700


>gb|CDF47262.1|+|cfr(B) [Clostridioides difficile]
MQQKNKYIRIQEFLKQNKFPNYRMKQITNAIFPGRINNFNEITVLPKSLRDMLIEEFGESILNIVPLKAQQSTQVSKVLFGISGDEKIET
VNMKYKAGWESFCISSQCGCNFGCKFCATGDIGLKRNLTSDEITDQILYFHLQGHSIDSISFMGMGEALANVQVFDALNVLTDPALFALS
PRRLSISTIGIIPNIKKLTQNYPQVNLTFSLHSPFNEQRSELMPINERYPLSDVMDTLDEHIRVTSRKVYIAYIMLHGVNDSIEHAKEVV
NLLRGRYRSGNLYHVNIIRYNPTVSSRMRFEEANEKCLVNFYKELKSAGIKVTIRSQFGIDIDAACGQLYGNYQKTNSQ


>gb|HG002396.1|+|5273-6322|cfr(B) [Clostridioides difficile]
ATGCAACAAAAAAATAAGTATATAAGAATTCAAGAGTTCTTGAAGCAGAATAAATTTCCTAATTATAGAATGAAACAAATTACAAATGCT
ATATTCCCAGGGAGAATAAATAATTTCAACGAAATAACGGTTCTTCCTAAATCACTAAGAGATATGTTAATTGAGGAGTTTGGAGAATCG
ATTTTAAATATTGTTCCTTTAAAAGCACAACAATCTACACAAGTTTCAAAAGTCTTATTTGGAATTTCAGGAGACGAAAAAATAGAAACG
GTAAATATGAAATATAAAGCTGGTTGGGAGTCATTTTGTATATCATCGCAGTGCGGTTGTAATTTTGGTTGTAAATTTTGTGCAACTGGA
GATATAGGTTTAAAACGTAACTTAACTTCAGATGAAATTACTGACCAGATTTTGTACTTTCACTTACAAGGGCATTCAATTGACAGTATT
TCTTTTATGGGAATGGGAGAAGCATTAGCGAATGTACAAGTTTTTGATGCTTTAAATGTACTTACAGATCCTGCGTTGTTTGCTTTAAGT
CCGCGTAGGTTATCTATATCCACTATAGGAATTATTCCAAACATTAAAAAATTGACTCAAAACTATCCGCAGGTCAACCTGACATTTTCA
TTACATTCTCCTTTTAATGAACAGCGAAGTGAGTTAATGCCAATTAATGAACGCTACCCATTATCAGATGTGATGGATACATTAGATGAG
CATATACGAGTAACCTCAAGAAAAGTTTATATTGCTTATATTATGTTGCACGGAGTTAATGATTCTATTGAACATGCGAAAGAAGTCGTA
AACCTTTTAAGAGGTAGATATAGGAGTGGGAACTTGTATCATGTGAACATCATTAGATATAACCCGACTGTTAGTTCACGGATGCGGTTT
GAAGAAGCAAATGAGAAATGTCTTGTCAACTTTTATAAAGAATTAAAGTCAGCAGGAATTAAAGTTACCATTAGAAGTCAATTTGGCATT
GATATAGACGCTGCTTGCGGTCAATTGTATGGAAACTATCAAAAAACCAATAGCCAGTAA