MCR-4.3

Accession ARO:3004695
DefinitionA plasmid-mediated MCR-4 variant and colistin resistance gene from clinical Enterobacteriaceae
AMR Gene FamilyMCR phosphoethanolamine transferase
Drug Classpeptide antibiotic
Resistance Mechanismantibiotic target alteration
ResistomesAcinetobacter baumanniip, Acinetobacter nosocomialiswgs, Enterobacter kobeiwgs, Providencia rettgeriwgs
Classification15 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ MCR phosphoethanolamine transferase [AMR Gene Family]
+ evolutionary_variant_of MCR-4.1
Publications

Partridge SR, et al. 2018. J. Antimicrob. Chemother. 73(10):2625-2630 Proposal for assignment of allele numbers for mobile colistin resistance (mcr) genes. (PMID 30053115)

Teo JWP, et al. 2018. J. Clin. Microbiol. 56(3): mcr-3 and mcr-4 Variants in Carbapenemase-Producing Clinical Enterobacteriaceae Do Not Confer Phenotypic Polymyxin Resistance. (PMID 29237785)

Resistomes

Prevalence of MCR-4.3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%1.16%0%
Acinetobacter nosocomialis0%0%2%
Enterobacter kobei0%0%1.56%
Providencia rettgeri0%0%7.69%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1000


>gb|AUI38915.1|+|MCR-4.3 [Enterobacter cloacae]
MISRFKTLSVNQFTFITALFYVAIFNLPLFGIVRKGIEKQPEVDPLFIASMPLFLTFALSFLFSIFTVKYLLKPFFIVLTLLSSSVFFAA
YQYNVVFDYGMIENTFQTHPAEALMYVNLASITNLLLTGLLPSYLIYKADIHYQPFFKELLHKLAFMLLMFVGIGIVAFFYYQDYAAFGR
NNSELRRYIVPTYFVSSASKYLNEHYLQTPMEYQQLGLDAKNASRNPNTKPNLLVFVVGETARSMSYQYYGYNKPTNAHTQNQGLIAFND
TSSCGTATAVSLPCMFSRMGRADYDPRRANAQDTVIDVLSHSGIKVQWFDNDSGCKGVCDQVENLTIDLKSDPKLCSGQYCFDQVLLNKL
DKILAVAPSQDTVIFLHIIGSHGPTYYLRYPPEHRKFIPDCPRSDIQNCSQEELINTYDNTILYTDFILSEVVNKLKGKQDMFDTAMLYL
SDHGESLGEKGMYLHGAPYSIAPKEQTSVPMLAWVSNDFSQDNQLNMTCVAQRAEQGGFSHDNLFDSLLGLMNVKTTVYQSQLDIFAPCR
Y


>gb|MG026621.1|+|1-1626|MCR-4.3 [Enterobacter cloacae]
GTGATTTCTAGATTTAAGACGTTATCGGTTAACCAATTCACTTTCATCACTGCGTTGTTTTATGTTGCCATTTTCAATCTACCGCTCTTT
GGTATAGTGCGAAAAGGAATTGAAAAACAACCAGAAGTTGATCCCCTTTTCATCGCATCTATGCCGCTATTTTTAACATTTGCGCTGAGT
TTTTTGTTTTCAATTTTTACCGTCAAATACCTGCTGAAGCCCTTTTTTATCGTATTGACGTTACTTTCCTCAAGTGTATTTTTTGCAGCC
TATCAATACAATGTCGTGTTTGACTACGGCATGATAGAAAACACGTTTCAAACACATCCTGCTGAAGCATTGATGTATGTAAATCTTGCA
TCAATTACCAATCTACTGCTGACTGGGCTATTACCGTCATATCTTATTTATAAGGCCGATATTCATTATCAGCCCTTTTTTAAGGAGTTA
TTGCATAAATTAGCCTTTATGCTGCTAATGTTCGTTGGCATTGGGATAGTCGCCTTTTTTTACTATCAAGATTATGCTGCATTTGGTCGA
AACAACAGTGAGTTAAGGCGTTACATTGTCCCTACCTATTTTGTCAGTAGTGCATCTAAATATCTCAATGAGCACTATTTGCAGACGCCC
ATGGAATACCAACAACTTGGCCTAGATGCGAAGAATGCCAGTCGTAACCCGAACACTAAACCTAACTTATTAGTGTTTGTTGTGGGTGAA
ACTGCGCGCTCAATGAGCTATCAATATTATGGATATAACAAGCCAACCAATGCTCATACCCAAAATCAGGGGCTGATTGCGTTTAACGAT
ACTAGCTCATGCGGCACGGCCACGGCGGTGTCTCTACCCTGTATGTTTTCACGAATGGGGCGGGCAGACTATGATCCTCGCCGTGCTAAT
GCTCAAGACACAGTGATTGATGTGTTAAGTCATAGTGGTATAAAAGTACAGTGGTTTGATAATGATTCTGGCTGTAAAGGTGTGTGTGAT
CAGGTTGAAAATCTCACGATAGATTTGAAGAGTGATCCGAAGCTGTGTTCTGGCCAATATTGTTTTGACCAAGTATTGCTCAACAAATTA
GATAAAATTCTGGCAGTAGCACCAAGTCAAGATACAGTAATTTTTTTGCATATCATTGGTAGTCATGGACCAACTTATTATCTTAGATAC
CCGCCAGAGCATCGTAAATTTATACCGGATTGTCCGCGCAGTGATATTCAAAATTGCAGTCAAGAAGAACTGATTAACACCTACGACAAC
ACTATTCTATATACGGATTTTATTCTCAGTGAAGTGGTGAATAAATTAAAAGGTAAGCAGGATATGTTCGATACTGCAATGCTGTATCTC
TCTGACCATGGTGAGTCTTTGGGTGAAAAGGGCATGTATTTACATGGTGCGCCCTATAGTATTGCACCGAAAGAACAAACTAGCGTACCA
ATGCTGGCTTGGGTATCTAATGACTTTAGCCAAGATAATCAGTTGAACATGACTTGTGTTGCACAGCGAGCAGAACAGGGCGGCTTTTCC
CACGACAATTTGTTCGACAGTTTGCTAGGACTTATGAATGTAAAAACCACCGTCTATCAGAGCCAACTCGATATTTTTGCACCTTGCAGG
TATTAG