blaS1

Accession ARO:3005111
CARD Short NameblaS1
DefinitionPredominant beta-lactamase in Mycolicibacterium smegmatis.
AMR Gene FamilyblaS
Drug Classpenam, cephalosporin, cephamycin
Resistance Mechanismantibiotic inactivation
Classification15 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ confers_resistance_to_antibiotic carbenicillin [Antibiotic]
+ confers_resistance_to_antibiotic oxacillin [Antibiotic]
+ confers_resistance_to_antibiotic ceftriaxone [Antibiotic]
+ confers_resistance_to_antibiotic piperacillin [Antibiotic]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic mezlocillin [Antibiotic]
+ confers_resistance_to_antibiotic cefixime [Antibiotic]
+ blaS [AMR Gene Family]
Publications

Quinting B, et al. 1997. FEMS Microbiol. Lett. 149(1):11-5 Purification and properties of the Mycobacterium smegmatis mc(2)155 beta-lactamase. (PMID 9103972)

Flores AR, et al. 2005. Microbiology (Reading, Engl.) 151(Pt 2):521-532 Genetic analysis of the beta-lactamases of Mycobacterium tuberculosis and Mycobacterium smegmatis and susceptibility to beta-lactam antibiotics. (PMID 15699201)

Resistomes

Prevalence of blaS1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAP97895.1|+|blaS1 [Mycolicibacterium smegmatis MC2 155]
MTNLSRRSVLIGSLAVMAAAGVRMPTASAAPVDDRIADLERRNNASIGIYAVDLDSNRTVAHRADDSFAMCSTFKAYLAARILRGAERGE
LSLDDRVFVDPAALLSNSPITETHAGGEMTLAELCQAALQRSDNAAANLLLKQIGGPAEITAFARSIGDQRTRLDRWETELNSAVPGDPR
DTSTPAALAGGFRAVLTGDVLAPPQRQLLDEWMRANETSSLRAGLPDGWTSADKTGSGDYGSTNDVGIAYGPQGQRILLALMVRTRGDDP
NADGFRPLIGELTALVLPELGVH


>gb|AY332268.1|+|927-1808|blaS1 [Mycolicibacterium smegmatis MC2 155]
ATGACGAATCTCTCACGACGCAGTGTGTTGATCGGATCCCTGGCAGTGATGGCGGCCGCCGGTGTGCGTATGCCGACGGCTTCCGCCGCT
CCCGTCGACGACCGGATCGCCGATCTCGAACGACGGAACAACGCATCCATCGGCATCTATGCCGTCGACCTCGATTCGAACCGTACGGTC
GCGCACCGCGCCGACGACTCGTTCGCGATGTGCTCGACGTTCAAGGCCTACCTCGCGGCCCGGATCCTGCGGGGCGCCGAGCGCGGCGAG
TTGTCGCTGGACGATCGTGTCTTCGTGGATCCCGCGGCGCTGCTGAGCAACTCGCCGATCACCGAGACACACGCAGGCGGCGAGATGACG
CTGGCCGAGTTGTGCCAGGCGGCACTGCAGCGCAGCGACAACGCCGCGGCCAACCTGTTGCTCAAGCAGATCGGCGGGCCGGCCGAGATC
ACCGCGTTCGCGCGGTCGATCGGCGACCAGCGCACACGCCTGGACCGCTGGGAGACCGAACTGAACTCGGCGGTGCCCGGCGATCCGCGT
GACACCAGCACCCCGGCCGCGCTGGCCGGTGGTTTCCGCGCCGTGCTGACCGGCGACGTGCTGGCCCCGCCGCAGCGTCAATTGCTCGAC
GAGTGGATGCGGGCCAACGAGACCTCCAGCCTGCGTGCGGGTTTGCCGGACGGCTGGACCAGTGCCGACAAGACCGGCAGCGGCGACTAC
GGATCCACCAACGATGTGGGTATCGCCTACGGCCCGCAGGGGCAGCGCATCCTGCTGGCGTTGATGGTGCGGACGCGCGGCGACGATCCG
AACGCGGACGGGTTCCGGCCCCTCATCGGGGAACTCACCGCGCTGGTGCTGCCCGAACTCGGCGTGCACTGA