Accession ARO:3000205
DefinitionTetX is a flavin-dependent monooxygenase conferring resistance to tetracycline antibiotics. TetX hydroxylates position 11a of the tetraketide group thus inactivating the antibiotic.
AMR Gene Familytetracycline inactivation enzyme
Drug Classtetracycline antibiotic, glycylcycline
Resistance Mechanismantibiotic inactivation
Classification10 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ tetracycline inactivation enzyme [AMR Gene Family]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ confers_resistance_to_antibiotic doxycycline [Antibiotic]
+ confers_resistance_to_antibiotic minocycline [Antibiotic]
+ confers_resistance_to_antibiotic chlortetracycline [Antibiotic]
+ confers_resistance_to_antibiotic demeclocycline [Antibiotic]
+ confers_resistance_to_antibiotic oxytetracycline [Antibiotic]
+ confers_resistance_to_antibiotic tigecycline [Antibiotic]
+ participates_in hydroxylation of antibiotic conferring resistance
Publications

Volkers G, et al. 2011. FEBS Lett 585(7): 1061-1066. Structural basis for a new tetracycline resistance mechanism relying on the TetX monooxygenase. (PMID 21402075)

Moore IF, et al. 2005. Biochemistry 44(35): 11829-11835. Tigecycline is modified by the flavin-dependent monooxygenase TetX. (PMID 16128584)

Yang W, et al. 2004. J Biol Chem 279(50): 52346-52352. TetX is a flavin-dependent monooxygenase conferring resistance to tetracycline antibiotics. (PMID 15452119)

Speer BS, et al. 1991. J Bacteriol 173(1): 176-183. Evidence that a novel tetracycline resistance gene found on two Bacteroides transposons encodes an NADP-requiring oxidoreductase. (PMID 1846135)

Resistomes

Prevalence of tetX among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 750


>gb|AAA27471.1|+|tetX [Bacteroides fragilis]
MTMRIDTDKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREARIFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMGVN
IADKKGNILSTKNVKPENRFDNPEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETADLVILANGGMSKVRKFVTD
TEVEETGTFNIQADIHQPEINCPGFFQLCNGNRLMASHQGNLLFANPNNNGALHFGISFKTPDEWKNQTQVDFQNRNSVVDFLLKEFSDW
DERYKELIHTTLSFVGLATRIFPLEKPWKSKRPLPITMIGDAAHLMPPFAGQGVNSGLVDALILSDNLADGKFNSIEEAVKNYEQQMFMY
GKEAQEESTQNEIEMFKPDFTFQQLLNV


>gb|M37699|+|586-1752|tetX [Bacteroides fragilis]
ATGACAATGCGAATAGATACAGACAAACAAATGAATTTACTTAGTGATAAGAACGTTGCAATAATTGGTGGTGGACCCGTTGGACTGACT
ATGGCAAAATTATTACAGCAAAACGGCATAGACGTTTCAGTTTACGAAAGAGACAACGACCGAGAGGCAAGAATTTTTGGTGGAACCCTT
GACCTACACAAAGGTTCAGGTCAGGAAGCAATGAAAAAAGCGGGATTGTTACAAACTTATTATGACTTAGCCTTACCAATGGGTGTAAAT
ATTGCTGATAAAAAAGGCAATATTTTATCCACAAAAAATGTAAAGCCCGAAAATCGATTTGACAATCCTGAAATAAACAGAAATGACTTA
AGGGCTATCTTGTTGAATAGTTTAGAAAACGACACGGTTATTTGGGATAGAAAACTTGTTATGCTTGAACCTGGTAAGAAGAAGTGGACA
CTAACTTTTGAGAATAAACCGAGTGAAACAGCAGATTTGGTTATTCTTGCCAATGGCGGGATGTCCAAGGTAAGAAAATTTGTTACCGAC
ACGGAAGTTGAAGAAACAGGTACTTTCAATATACAAGCCGATATTCATCAACCAGAGATAAACTGTCCTGGATTTTTTCAGCTATGCAAT
GGAAACCGGCTAATGGCATCTCACCAAGGTAATTTATTATTTGCTAACCCCAATAATAATGGTGCATTGCATTTTGGAATAAGTTTTAAA
ACACCTGATGAATGGAAAAACCAAACGCAGGTAGATTTTCAAAACAGAAATAGTGTCGTTGATTTTCTTCTGAAAGAATTTTCCGATTGG
GACGAACGCTACAAAGAATTGATTCATACGACGTTGTCATTTGTAGGATTGGCTACACGGATATTTCCTTTAGAAAAGCCTTGGAAAAGC
AAGCGCCCATTACCCATAACAATGATTGGGGATGCCGCACATTTGATGCCGCCTTTTGCAGGGCAGGGAGTAAATAGTGGGTTGGTGGAT
GCCTTGATATTGTCTGATAATCTAGCCGATGGAAAATTTAATAGCATTGAAGAGGCTGTTAAAAATTATGAACAGCAAATGTTTATGTAT
GGCAAAGAAGCACAAGAAGAATCAACTCAAAACGAAATTGAAATGTTTAAACCCGACTTTACGTTTCAGCAATTGTTAAATGTATAA