mphB

Accession ARO:3000318
Synonym(s)macrolide 2'-phosphotransferase II
CARD Short NamemphB
DefinitionThe mphB gene encodes for MPH(2')-II. This enzymes phosphorylates 14-membered and 16-membered macrolides. It phosphorylates macrolides in GTP- dependent manner at 2'-OH hydroxyl of desosamine sugar of macrolides.
AMR Gene Familymacrolide phosphotransferase (MPH)
Drug Classmacrolide antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesEnterobacter roggenkampiiwgs, Escherichia colip+wgs, Escherichia fergusoniiwgs, Klebsiella pneumoniaewgs, Salmonella entericap+wgs, Streptococcus uberiswgs
Resistomes with Sequence VariantsEnterobacter hormaecheiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Escherichia fergusoniiwgs, Klebsiella pneumoniaewgs, Salmonella entericap+wgs, Streptococcus uberiswgs
Classification9 ontology terms | Show
Parent Term(s)10 ontology terms | Show
+ macrolide phosphotransferase (MPH) [AMR Gene Family]
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic telithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic tylosin [Antibiotic]
+ confers_resistance_to_antibiotic spiramycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ confers_resistance_to_antibiotic dirithromycin [Antibiotic]
+ confers_resistance_to_antibiotic oleandomycin [Antibiotic]
Publications

Noguchi N, et al. 1996. FEMS Microbiol Lett 144(2-3): 197-202. Cloning and nucleotide sequence of the mphB gene for macrolide 2'-phosphotransferase II in Escherichia coli. (PMID 8900063)

Kono M, et al. 1992. FEMS Microbiol Lett 76(1-2): 89-94. Purification and characterization of macrolide 2'-phosphotransferase type II from a strain of Escherichia coli highly resistant to macrolide antibiotics. (PMID 1330822)

Noguchi N, et al. 1998. FEMS Microbiol Lett 159(2): 337-342. Expression of the mphB gene for macrolide 2'-phosphotransferase II from Escherichia coli in Staphylococcus aureus. (PMID 9503630)

Chesneau O, et al. 2007. FEMS Microbiol Lett 269(2): 317-322. Resistance phenotypes conferred by macrolide phosphotransferases. (PMID 17302923)

Pawlowski AC, et al. 2018. Nat Commun 9(1):112 The evolution of substrate discrimination in macrolide antibiotic resistance enzymes. (PMID 29317655)

Resistomes

Prevalence of mphB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Enterobacter hormaechei0%0%0.05%0%
Enterobacter roggenkampii0%0%0.4%0%
Escherichia coli0%0.03%0.52%0%
Escherichia fergusonii0%0%1.41%0%
Klebsiella pneumoniae0%0%0.04%0%
Salmonella enterica0%0.14%0.06%0%
Streptococcus uberis0%0%1.9%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 600


>gb|BAA12910.1|+|mphB [Escherichia coli]
MSKDIKQVIEIAKKHNLFLKEETIQFNESGLDFQAVFAQDNNGIDWVLRLPRREDVMPRTKVEKQALDLVNKYAISFQAPNWIIYTEELI
AYKKLDGVPAGTIDHNIGNYIWEIDINNVPELFHKSLGRVLAELHSIPSNKAAALDLVVHTPEEARMSMKQRMDAVRAKFGVGENLWNRW
QAWLNDDDMWPKKTGLIHGDVHAGHTMIDKDANVTGLIDWTEAKVTDVSHDFIFNYRAFGEEGLEALILAYKEIGGYYWPKMKEHIIELN
AAYPVSIAEFALVSGIEEYEQMAKEALEVQGS


>gb|D85892.1|+|1159-2067|mphB [Escherichia coli]
ATGAGTAAAGATATTAAACAAGTAATCGAGATAGCAAAAAAACACAATCTTTTTCTAAAAGAAGAAACGATACAGTTTAATGAATCAGGG
CTTGATTTTCAAGCTGTTTTTGCACAAGATAATAATGGAATTGATTGGGTTCTAAGATTGCCTAGACGGGAAGATGTGATGCCTAGAACA
AAGGTAGAAAAACAAGCTTTGGATTTGGTAAATAAGTACGCTATATCCTTTCAGGCACCAAACTGGATCATTTACACAGAGGAACTAATA
GCTTATAAAAAGTTAGATGGTGTGCCAGCAGGTACGATAGATCATAACATAGGTAACTATATTTGGGAGATAGACATAAATAATGTTCCA
GAATTATTTCACAAGTCGCTAGGCAGGGTGTTAGCAGAGCTTCATAGCATACCTAGTAATAAAGCCGCAGCGCTTGATCTTGTAGTACAC
ACACCAGAAGAAGCAAGAATGTCAATGAAGCAGCGTATGGATGCAGTAAGAGCAAAGTTCGGAGTAGGTGAGAATCTATGGAACAGATGG
CAAGCGTGGTTGAATGATGATGATATGTGGCCTAAGAAAACTGGACTGATTCATGGAGATGTACATGCCGGACATACTATGATTGATAAG
GATGCCAATGTGACTGGATTAATCGATTGGACTGAAGCGAAGGTTACAGATGTTTCGCATGACTTTATTTTCAACTATAGAGCTTTTGGG
GAAGAAGGGTTAGAAGCTTTAATTCTCGCTTATAAGGAAATTGGTGGATATTACTGGCCTAAAATGAAAGAGCATATTATCGAACTTAAT
GCAGCATACCCAGTTTCAATCGCTGAGTTTGCATTAGTGTCTGGAATTGAGGAATATGAGCAGATGGCAAAGGAAGCATTGGAAGTACAA
GGTTCGTAA