Accession ARO:3000858
DefinitionArmA is a 16S rRNA methyltransferase that targets mature or nearly mature 30S subunits. It transfers a methyl group from S-adenosyl-L-methionine to N7-G1405 of the 16S rRNA, an aminoglycoside binding site.
AMR Gene Family16S rRNA methyltransferase (G1405)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
ResistomesAcinetobacter baumanniig+p+wgs, Citrobacter freundiip+wgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiiwgs, Proteus mirabilisp+wgs, Providencia rettgerig+wgs, Providencia stuartiip+wgs, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Salmonella entericap+wgs, Vibrio choleraewgs
Classification12 ontology terms | Show
Parent Term(s)12 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin C [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic G418 [Antibiotic]
+ confers_resistance_to_antibiotic arbekacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ 16S rRNA methyltransferase (G1405) [AMR Gene Family]
Publications

Schmitt E, et al. 2009. J Mol Biol 388(3): 570-582. Structural bases for 16 S rRNA methylation catalyzed by ArmA and RmtB methyltransferases. (PMID 19303884)

Zarubica T, et al. 2011. RNA 17(2): 346-355. The aminoglycoside resistance methyltransferases from the ArmA/Rmt family operate late in the 30S ribosomal biogenesis pathway. (PMID 21177880)

Gurung M, et al. 2010. Diagn. Microbiol. Infect. Dis. 68(4):468-70 Emergence of 16S rRNA methylase gene armA and cocarriage of bla(IMP-1) in Pseudomonas aeruginosa isolates from South Korea. (PMID 20926221)

Shrestha S, et al. 2016. J Nepal Health Res Counc 14(33):72-76 Emergence of Aminoglycoside Resistance Due to armA methylase in Multi-drug Resistant Acinetobacter Baumannii Isolates in a University Hospital in Nepal. (PMID 27885285)

Resistomes

Prevalence of armA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 85 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii42.68%3.2%33.25%
Citrobacter freundii0%2.33%2.33%
Enterobacter cloacae0%0%0.45%
Enterobacter hormaechei0%1.8%1.58%
Enterobacter kobei0%0%14.06%
Escherichia coli0.04%0.03%0.17%
Klebsiella pneumoniae2.17%0.82%4.05%
Morganella morganii0%0%2.38%
Proteus mirabilis0%7.41%0.86%
Providencia rettgeri50%0%7.69%
Providencia stuartii0%7.14%7.69%
Pseudomonas aeruginosa0%0%0.15%
Raoultella planticola0%0%5.26%
Salmonella enterica0%0.36%0.44%
Vibrio cholerae0%0%0.11%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 450


>gb|ADC55560.1|+|armA [Pseudomonas aeruginosa]
MDKNDVVKKILESKKYENLDSDIVEKVVSISEKKYKLKEVENYSKKKLHQIWGSYYSAYPNWDKLLKKYNQGQLSIEDLLKIHSSTNERV
ATLNDFYTYVFGNIKHVSSILDFGCGFNPLALYQWNENEKIIYHAYDIDRAEIAFLSSIIGKLKTTIKYRFLNKESDVYKGTYDVVFLLK
MLPVLKQQDVNILDFLQLFHTQNFVISFPIKSLSGKEKGMEENYQLWFESFTKGWIKILDSKVIGNELVYITSGFQK


>gb|GU437214.1|+|1-774|armA [Pseudomonas aeruginosa]
ATGGATAAGAATGATGTTGTTAAGAAGATACTTGAATCAAAAAAGTACGAAAACCTTGATTCAGATATTGTTGAAAAGGTTGTTTCCATT
TCTGAGAAGAAATATAAATTAAAGGAAGTTGAGAATTATTCTAAAAAGAAATTGCATCAAATATGGGGGTCTTACTATTCTGCCTATCCT
AATTGGGATAAATTATTAAAAAAGTACAATCAGGGGCAGTTATCAATAGAAGATTTACTAAAGATTCATTCTTCGACGAATGAAAGAGTC
GCAACATTAAATGACTTTTACACTTATGTATTTGGAAATATCAAACATGTCTCATCTATTTTAGATTTTGGTTGTGGCTTCAATCCATTA
GCTTTATACCAATGGAATGAAAATGAAAAAATAATATATCATGCATACGATATTGATAGAGCTGAGATAGCTTTTTTGAGTAGCATTATT
GGGAAGTTAAAGACGACGATAAAGTATAGGTTTTTGAATAAAGAGAGTGATGTCTACAAAGGTACTTATGATGTAGTATTCCTTTTAAAG
ATGCTTCCTGTGCTAAAACAGCAAGATGTAAATATCTTGGATTTCCTACAGCTTTTTCATACTCAAAACTTTGTAATATCTTTTCCAATA
AAGTCTTTATCTGGAAAGGAGAAGGGAATGGAAGAGAATTACCAGCTATGGTTTGAATCTTTTACAAAAGGTTGGATAAAAATCCTTGAT
TCGAAGGTTATAGGGAATGAGTTAGTATATATTACTAGTGGATTTCAGAAATAA