Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000858
CARD Short NamearmA
DefinitionArmA is a 16S rRNA methyltransferase that targets mature or nearly mature 30S subunits. It transfers a methyl group from S-adenosyl-L-methionine to N7-G1405 of the 16S rRNA, an aminoglycoside binding site.
AMR Gene Family16S rRNA methyltransferase (G1405)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONKlebsiella pneumoniae (18), Acinetobacter baumannii (16), Escherichia coli (13), Enterobacter cloacae (9), Enterobacteriaceae (9), Pseudomonas aeruginosa (4), Acinetobacter (3), Serratia marcescens (3), Enterobacter (3), Citrobacter freundii (2)
GAZAmes (5), China (4), Europe (3), Japan (3), Poland (3), Nepal (2), New Delhi (2), Viet Nam (2)
FOODON
ENVOhospital (7)
UBERON
Classification12 ontology terms | Show
Parent Term(s)12 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin C [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic G418 [Antibiotic]
+ confers_resistance_to_antibiotic arbekacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ 16S rRNA methyltransferase (G1405) [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs+gi, Acinetobacter nosocomialiswgs, Aeromonas caviaewgs, Aeromonas hydrophilap+wgs, Citrobacter freundiip+wgs, Citrobacter portucalensisp, Citrobacter werkmaniiwgs, Citrobacter youngaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+gi, Morganella morganiiwgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp, Providencia rettgerig+p+wgs+gi, Providencia stuartiip+wgs, Pseudomonas aeruginosap+wgs, Raoultella planticolawgs, Salmonella entericag+p+wgs+gi, Serratia marcescenswgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs+gi, Acinetobacter nosocomialiswgs, Aeromonas caviaewgs, Aeromonas hydrophilap+wgs, Citrobacter freundiip+wgs, Citrobacter portucalensisp, Citrobacter werkmaniiwgs, Citrobacter youngaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeig+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+gi, Morganella morganiiwgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp, Providencia rettgerig+p+wgs+gi, Providencia stuartiip+wgs, Pseudomonas aeruginosap+wgs, Raoultella planticolawgs, Salmonella entericag+p+wgs+gi, Serratia marcescenswgs, Vibrio choleraewgs
Publications

Schmitt E, et al. 2009. J Mol Biol 388(3): 570-582. Structural bases for 16 S rRNA methylation catalyzed by ArmA and RmtB methyltransferases. (PMID 19303884)

Zarubica T, et al. 2011. RNA 17(2): 346-355. The aminoglycoside resistance methyltransferases from the ArmA/Rmt family operate late in the 30S ribosomal biogenesis pathway. (PMID 21177880)

Gurung M, et al. 2010. Diagn. Microbiol. Infect. Dis. 68(4):468-70 Emergence of 16S rRNA methylase gene armA and cocarriage of bla(IMP-1) in Pseudomonas aeruginosa isolates from South Korea. (PMID 20926221)

Shrestha S, et al. 2016. J Nepal Health Res Counc 14(33):72-76 Emergence of Aminoglycoside Resistance Due to armA methylase in Multi-drug Resistant Acinetobacter Baumannii Isolates in a University Hospital in Nepal. (PMID 27885285)

Resistomes

Prevalence of armA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii35.93%1.35%42.81%15.72%0%
Acinetobacter nosocomialis0%0%0.57%0%0%
Aeromonas caviae0%0%0.54%0%0%
Aeromonas hydrophila0%2.6%0.81%0%0%
Citrobacter freundii0%0.31%1.55%0%0%
Citrobacter portucalensis0%2.94%0%0%0%
Citrobacter werkmanii0%0%51.28%0%0%
Citrobacter youngae0%9.09%6.25%0%0%
Enterobacter cloacae0%0.56%0.96%0%0%
Enterobacter hormaechei0%0.51%2.59%0%0%
Enterobacter kobei4.55%0%4.37%0%0%
Enterobacter roggenkampii0%0%1.8%0%0%
Escherichia coli0.12%0.07%0.35%0%0%
Klebsiella aerogenes0%1.09%0.28%0%0%
Klebsiella michiganensis0%0.57%0.53%0%0%
Klebsiella pneumoniae1.24%1.55%4.74%3.81%0%
Klebsiella quasipneumoniae0%0.64%9.47%0%0%
Leclercia adecarboxylata7.14%0%0%50%0%
Morganella morganii0%0%1.23%0%0%
Proteus mirabilis1.83%2.5%1.49%0%0%
Proteus vulgaris0%11.11%0%0%0%
Providencia rettgeri5.88%2.7%1.27%50%0%
Providencia stuartii0%2.27%2.27%0%0%
Pseudomonas aeruginosa0%0.29%0.24%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica0.5%0.6%0.44%0.99%0%
Serratia marcescens0%0%0.13%0%0%
Vibrio cholerae0%0%0.19%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|ADC55560.1|+|armA [Pseudomonas aeruginosa]
MDKNDVVKKILESKKYENLDSDIVEKVVSISEKKYKLKEVENYSKKKLHQIWGSYYSAYPNWDKLLKKYNQGQLSIEDLLKIHSSTNERV
ATLNDFYTYVFGNIKHVSSILDFGCGFNPLALYQWNENEKIIYHAYDIDRAEIAFLSSIIGKLKTTIKYRFLNKESDVYKGTYDVVFLLK
MLPVLKQQDVNILDFLQLFHTQNFVISFPIKSLSGKEKGMEENYQLWFESFTKGWIKILDSKVIGNELVYITSGFQK


>gb|GU437214.1|+|1-774|armA [Pseudomonas aeruginosa]
ATGGATAAGAATGATGTTGTTAAGAAGATACTTGAATCAAAAAAGTACGAAAACCTTGATTCAGATATTGTTGAAAAGGTTGTTTCCATT
TCTGAGAAGAAATATAAATTAAAGGAAGTTGAGAATTATTCTAAAAAGAAATTGCATCAAATATGGGGGTCTTACTATTCTGCCTATCCT
AATTGGGATAAATTATTAAAAAAGTACAATCAGGGGCAGTTATCAATAGAAGATTTACTAAAGATTCATTCTTCGACGAATGAAAGAGTC
GCAACATTAAATGACTTTTACACTTATGTATTTGGAAATATCAAACATGTCTCATCTATTTTAGATTTTGGTTGTGGCTTCAATCCATTA
GCTTTATACCAATGGAATGAAAATGAAAAAATAATATATCATGCATACGATATTGATAGAGCTGAGATAGCTTTTTTGAGTAGCATTATT
GGGAAGTTAAAGACGACGATAAAGTATAGGTTTTTGAATAAAGAGAGTGATGTCTACAAAGGTACTTATGATGTAGTATTCCTTTTAAAG
ATGCTTCCTGTGCTAAAACAGCAAGATGTAAATATCTTGGATTTCCTACAGCTTTTTCATACTCAAAACTTTGTAATATCTTTTCCAATA
AAGTCTTTATCTGGAAAGGAGAAGGGAATGGAAGAGAATTACCAGCTATGGTTTGAATCTTTTACAAAAGGTTGGATAAAAATCCTTGAT
TCGAAGGTTATAGGGAATGAGTTAGTATATATTACTAGTGGATTTCAGAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit