Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000860
CARD Short NamermtB
DefinitionRmtB is a 16S rRNA methyltransferase that targets mature or nearly mature 30S subunits. It transfers a methyl group from S-adenosyl-L-methionine to N7-G1405 of the 16S rRNA, an aminoglycoside binding site.
AMR Gene Family16S rRNA methyltransferase (G1405)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (37), Klebsiella pneumoniae (27), Enterobacteriaceae (12), Pseudomonas aeruginosa (5), Enterobacter cloacae (4), Acinetobacter baumannii (4), Proteus mirabilis (4), Enterobacter (2), Citrobacter freundii (2), Bacilli (2)
GAZChina (16), Ames (7), Europe (4), Japan (3)
FOODONswine (5)
ENVOhospital (8), farm (7)
UBERONanimal hemisphere (2)
Classification12 ontology terms | Show
Parent Term(s)12 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin C [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic G418 [Antibiotic]
+ confers_resistance_to_antibiotic arbekacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ 16S rRNA methyltransferase (G1405) [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas caviaeg, Aeromonas hydrophilawgs, Citrobacter portucalensisp, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiig+wgs, Proteus mirabilisg+p+wgs+gi, Providencia rettgerig, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Salmonella entericag+p+wgs+gi, Shigella flexneriwgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas caviaeg, Aeromonas hydrophilawgs, Burkholderia cenocepaciawgs, Citrobacter portucalensisp, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs+gi, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiig+wgs, Proteus mirabilisg+p+wgs+gi, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs+gi, Salmonella entericag+p+wgs+gi, Shigella flexneriwgs
Publications

Schmitt E, et al. 2009. J Mol Biol 388(3): 570-582. Structural bases for 16 S rRNA methylation catalyzed by ArmA and RmtB methyltransferases. (PMID 19303884)

Zhou Y, et al. 2010. Eur. J. Clin. Microbiol. Infect. Dis. 29(11):1349-53 Distribution of 16S rRNA methylases among different species of Gram-negative bacilli with high-level resistance to aminoglycosides. (PMID 20614151)

Resistomes

Prevalence of rmtB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.03%0%0%
Aeromonas caviae2.27%0%0%0%0%
Aeromonas hydrophila0%0%0.81%0%0%
Burkholderia cenocepacia0%0%1.97%0%0%
Citrobacter portucalensis0%1.47%0%0%0%
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter cloacae0%1.12%1.6%0%0%
Enterobacter hormaechei0.36%0.19%0.65%3.33%0%
Escherichia coli0.14%0.63%2.14%0.13%0%
Escherichia fergusonii0%0.36%1.09%0%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella pneumoniae0.18%2.99%10.28%0%0%
Klebsiella quasipneumoniae0%0%0.13%0%0%
Morganella morganii1.92%0%2.45%0%0%
Proteus mirabilis3.67%2.5%1.16%3.7%0%
Providencia rettgeri2.94%0%0.64%0%0%
Providencia stuartii0%0%2.27%0%0%
Pseudomonas aeruginosa0.77%0.29%0.81%1.39%0%
Salmonella enterica0.38%0.44%0.2%0.66%0%
Shigella flexneri0%0%0.16%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 450


>gb|CAP07796.1|+|rmtB [Escherichia coli]
MNINDALTSILASKKYRALCPDTVRRILTEEWGRHKSPKQTVEAARTRLHGICGAYVTPESLKAAAAALSAGDVKKALSLHASTKERLAE
LDTLYDFIFSAETPRRVLDIACGLNPLALYERGIASVWGCDIHQGLGDVITPFAREKDWDFTFALQDVLCAPPAEAGDLALIFKLLPLLE
REQAGSAMALLQSLNTPRMAVSFPTRSLGGRGKGMEANYAAWFEGGLPAEFEIEDKKTIGTELIYLIKKNG


>gb|AM886293.1|+|116480-117235|rmtB [Escherichia coli]
ATGAACATCAACGATGCCCTCACCTCCATCCTGGCCTCAAAAAAATACCGCGCCCTTTGCCCGGATACCGTGCGGCGCATCCTGACTGAG
GAATGGGGGCGGCATAAATCCCCCAAACAGACCGTAGAGGCTGCACGCACCCGGCTGCATGGAATTTGCGGGGCATATGTCACCCCGGAA
TCGCTCAAGGCTGCTGCCGCCGCGCTTTCTGCGGGCGATGTAAAAAAGGCATTGTCGCTGCATGCCTCCACCAAGGAGCGACTGGCCGAG
CTGGATACCCTGTACGATTTTATCTTTTCAGCCGAAACTCCCCGCCGCGTGCTGGATATCGCCTGCGGTCTTAACCCCTTGGCGCTATAC
GAGCGCGGCATTGCATCCGTGTGGGGCTGTGATATCCACCAGGGATTGGGGGATGTCATCACCCCCTTTGCTAGGGAAAAAGATTGGGAT
TTTACCTTTGCCCTGCAGGATGTGCTGTGTGCGCCGCCCGCCGAAGCCGGCGACCTGGCGCTGATTTTTAAGCTTTTGCCCCTGCTGGAG
CGGGAGCAGGCCGGTTCTGCCATGGCACTTTTACAATCCCTCAATACCCCGCGCATGGCTGTCAGCTTTCCCACGCGTAGTTTAGGCGGG
CGTGGAAAAGGCATGGAGGCGAACTACGCCGCATGGTTCGAGGGCGGCTTGCCCGCCGAGTTTGAGATTGAGGATAAAAAGACCATCGGA
ACAGAACTTATATACTTGATAAAAAAGAATGGATAA

Curator Acknowledgements
Curator Description Most Recent Edit