rmtC

Accession ARO:3000861
DefinitionRmtC is a rRNA methyltransferase found in Proteus mirabilis with high level resistance to similar to aminoglycosides, with the exception of non-4,6-disubstituted deoxystreptamines (streptomycin and neomycin). It has also been isolated in Salmonella enterica ser. Virchow. It is hypothesized to methylate G1405, like related methyltransferases RmtA, RmtB, and ArmA.
AMR Gene Family16S rRNA methyltransferase (G1405)
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic target alteration
ResistomesEnterobacter asburiaewgs, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella pneumoniaep+wgs, Salmonella entericawgs, Serratia marcescensp+wgs, Shigella sonneiwgs
Classification12 ontology terms | Show
Parent Term(s)12 ontology terms | Show
+ confers_resistance_to_antibiotic dibekacin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin C [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic G418 [Antibiotic]
+ confers_resistance_to_antibiotic arbekacin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ 16S rRNA methyltransferase (G1405) [AMR Gene Family]
Publications

Wachino J, et al. 2005. Antimicrob Agents Chemother 50(1): 178-184. Novel plasmid-mediated 16S rRNA methylase, RmtC, found in a proteus mirabilis isolate demonstrating extraordinary high-level resistance against various aminoglycosides. (PMID 16377684)

Zarubica T, et al. 2011. RNA 17(2): 346-355. The aminoglycoside resistance methyltransferases from the ArmA/Rmt family operate late in the 30S ribosomal biogenesis pathway. (PMID 21177880)

Hopkins KL, et al. 2010. Emerg Infect Dis 16(4): 712-715. 16S rRNA methyltransferase RmtC in Salmonella enterica serovar Virchow. (PMID 20350396)

Rahman M, et al. 2015. Emerging Infect. Dis. 21(11):2059-62 RmtC and RmtF 16S rRNA Methyltransferase in NDM-1-Producing Pseudomonas aeruginosa. (PMID 26488937)

Resistomes

Prevalence of rmtC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 85 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Citrobacter freundii0%0%1.55%
Enterobacter asburiae0%0%6.25%
Enterobacter cloacae0%1.3%0.45%
Enterobacter hormaechei0%0%1.74%
Enterobacter kobei0%0%3.12%
Escherichia coli0%0.07%0.07%
Klebsiella pneumoniae0%0.38%0.84%
Morganella morganii0%0%2.38%
Providencia rettgeri0%0%0%
Providencia stuartii0%0%0%
Salmonella enterica0%0%0.01%
Serratia marcescens0%6.56%0.92%
Shigella sonnei0%0%0.08%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AIA09786.1|+|rmtC [Pseudomonas aeruginosa]
MKTNDNYIEEVTAKVLTSGKYSTLYPPTVRRVTERLFDRYPPKQLEKEVRKKLHQAYGAYIGGIDGKRLEKKIEKIIHEIPNPTTDEATR
TEWEKEICLKILNLHTSTNERTVAYDELYQKIFEVTGVPTSITDAGCALNPFSFPFFTEAGMLGQYIGFDLDKGMIEAIEHSLRTLNAPE
GIVVKQGDILSDPSGESDLLLMFKLYTLLDRQEEASGLKILQEWKYKNAVISFPIKTISGRDVGMEENYTVKFENDLVGSDLRIMQKLKL
GNEMYFIVSRL


>gb|KJ476816.1|+|80-925|rmtC [Pseudomonas aeruginosa]
ATGAAAACCAACGATAATTATATCGAAGAAGTAACAGCCAAAGTACTCACAAGTGGTAAATACTCCACACTTTATCCACCAACTGTACGA
CGTGTAACTGAGAGGCTTTTCGATCGATACCCTCCCAAGCAGCTAGAGAAGGAGGTTCGCAAGAAATTGCATCAAGCATATGGTGCTTAT
ATTGGTGGGATCGATGGGAAAAGGTTGGAGAAGAAGATTGAGAAGATAATTCATGAGATACCAAATCCAACTACGGATGAAGCAACTCGT
ACGGAGTGGGAAAAAGAGATCTGCCTGAAAATATTGAACTTGCACACTTCAACAAATGAGCGAACGGTGGCTTACGATGAGCTTTACCAA
AAGATCTTTGAGGTAACAGGGGTTCCAACAAGTATCACCGATGCAGGTTGCGCTTTGAATCCATTTTCTTTTCCATTCTTTACGGAGGCT
GGCATGCTTGGGCAATACATAGGTTTCGATCTTGATAAAGGTATGATCGAAGCGATCGAACACTCGTTGAGAACGCTTAACGCCCCAGAG
GGTATTGTTGTCAAACAGGGAGATATATTATCCGATCCGTCAGGCGAGAGTGATCTTCTACTTATGTTCAAGCTATATACTCTACTCGAT
CGGCAGGAAGAGGCCTCTGGTTTGAAAATTCTTCAAGAGTGGAAATACAAAAATGCTGTGATCTCTTTTCCTATTAAAACTATAAGTGGG
AGAGATGTTGGGATGGAAGAGAATTACACTGTTAAGTTCGAGAATGATCTTGTTGGGTCAGATCTGAGAATCATGCAAAAATTGAAATTA
GGAAACGAGATGTATTTTATCGTATCGAGATTGTAA