rmtC

Download Sequences

Accession	ARO:3000861
CARD Short Name	rmtC
Definition	RmtC is a rRNA methyltransferase found in Proteus mirabilis with high level resistance to similar to aminoglycosides, with the exception of non-4,6-disubstituted deoxystreptamines (streptomycin and neomycin). It has also been isolated in Salmonella enterica ser. Virchow. It is hypothesized to methylate G1405, like related methyltransferases RmtA, RmtB, and ArmA.
AMR Gene Family	16S rRNA methyltransferase (G1405)
Drug Class	aminoglycoside antibiotic
Resistance Mechanism	antibiotic target alteration
Resistomes with Perfect Matches	Acinetobacter baumannii^wgs, Aeromonas veronii^wgs, Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Providencia rettgeri^wgs, Salmonella enterica^p+wgs, Serratia marcescens^p+wgs, Shigella sonnei^wgs, Vibrio vulnificus^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^wgs, Aeromonas veronii^wgs, Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter portucalensis^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Providencia rettgeri^wgs, Salmonella enterica^p+wgs, Serratia marcescens^p+wgs, Shigella sonnei^wgs, Vibrio vulnificus^wgs
Classification	12 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic target alteration [Resistance Mechanism] + antibiotic target modifying enzyme + ribosomal alteration conferring antibiotic resistance + antibiotic molecule + antibiotic mixture + rRNA methyltransferase conferring antibiotic resistance + aminoglycoside antibiotic [Drug Class] + gentamicin [Antibiotic] + 16S ribosomal RNA methyltransferase
Parent Term(s)	12 ontology terms \| Show + confers_resistance_to_antibiotic dibekacin [Antibiotic] + confers_resistance_to_antibiotic amikacin [Antibiotic] + confers_resistance_to_antibiotic gentamicin C [Antibiotic] + confers_resistance_to_antibiotic sisomicin [Antibiotic] + confers_resistance_to_antibiotic netilmicin [Antibiotic] + confers_resistance_to_antibiotic kanamycin A [Antibiotic] + confers_resistance_to_antibiotic tobramycin [Antibiotic] + confers_resistance_to_antibiotic isepamicin [Antibiotic] + confers_resistance_to_antibiotic G418 [Antibiotic] + confers_resistance_to_antibiotic arbekacin [Antibiotic] + confers_resistance_to_antibiotic gentamicin B [Antibiotic] + 16S rRNA methyltransferase (G1405) [AMR Gene Family]
Publications	Wachino J, et al. 2005. Antimicrob Agents Chemother 50(1): 178-184. Novel plasmid-mediated 16S rRNA methylase, RmtC, found in a proteus mirabilis isolate demonstrating extraordinary high-level resistance against various aminoglycosides. (PMID 16377684) Zarubica T, et al. 2011. RNA 17(2): 346-355. The aminoglycoside resistance methyltransferases from the ArmA/Rmt family operate late in the 30S ribosomal biogenesis pathway. (PMID 21177880) Hopkins KL, et al. 2010. Emerg Infect Dis 16(4): 712-715. 16S rRNA methyltransferase RmtC in Salmonella enterica serovar Virchow. (PMID 20350396) Rahman M, et al. 2015. Emerging Infect. Dis. 21(11):2059-62 RmtC and RmtF 16S rRNA Methyltransferase in NDM-1-Producing Pseudomonas aeruginosa. (PMID 26488937)

Resistomes

Prevalence of rmtC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0%	0%	0.01%	0%	0%
Acinetobacter baumannii	0%	0%	0.01%	0%	0%
Aeromonas veronii	0%	0%	0.56%	0%	0%
Aeromonas veronii	0%	0%	0.56%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter freundii	0%	0%	0.58%	0%	0%
Citrobacter freundii	0%	0%	0.58%	0%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%	0%
Enterobacter asburiae	0%	0%	1.19%	0%	0%
Enterobacter asburiae	0%	0%	1.19%	0%	0%
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter cloacae	0%	0%	0.32%	0%	0%
Enterobacter hormaechei	0%	0%	0.65%	0%	0%
Enterobacter hormaechei	0%	0%	0.65%	0%	0%
Enterobacter kobei	0%	0%	0.44%	0%	0%
Enterobacter kobei	0%	0%	0.44%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%	0%
Escherichia coli	0%	0.08%	0.15%	0%	0%
Escherichia coli	0%	0.08%	0.15%	0%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Klebsiella pneumoniae	0%	0.18%	0.62%	0%	0%
Klebsiella pneumoniae	0%	0.18%	0.62%	0%	0%
Providencia rettgeri	0%	0%	1.91%	0%	0%
Providencia rettgeri	0%	0%	1.91%	0%	0%
Salmonella enterica	0%	0.05%	0.01%	0%	0%
Salmonella enterica	0%	0.05%	0.01%	0%	0%
Serratia marcescens	0%	0.65%	0.79%	0%	0%
Serratia marcescens	0%	0.65%	0.79%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%
Shigella sonnei	0%	0%	0.07%	0%	0%
Vibrio vulnificus	0%	0%	2.04%	0%	0%
Vibrio vulnificus	0%	0%	2.04%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AIA09786.1|+|rmtC [Pseudomonas aeruginosa]
MKTNDNYIEEVTAKVLTSGKYSTLYPPTVRRVTERLFDRYPPKQLEKEVRKKLHQAYGAYIGGIDGKRLEKKIEKIIHEIPNPTTDEATR
TEWEKEICLKILNLHTSTNERTVAYDELYQKIFEVTGVPTSITDAGCALNPFSFPFFTEAGMLGQYIGFDLDKGMIEAIEHSLRTLNAPE
GIVVKQGDILSDPSGESDLLLMFKLYTLLDRQEEASGLKILQEWKYKNAVISFPIKTISGRDVGMEENYTVKFENDLVGSDLRIMQKLKL
GNEMYFIVSRL

>gb|KJ476816.1|+|80-925|rmtC [Pseudomonas aeruginosa]
ATGAAAACCAACGATAATTATATCGAAGAAGTAACAGCCAAAGTACTCACAAGTGGTAAATACTCCACACTTTATCCACCAACTGTACGA
CGTGTAACTGAGAGGCTTTTCGATCGATACCCTCCCAAGCAGCTAGAGAAGGAGGTTCGCAAGAAATTGCATCAAGCATATGGTGCTTAT
ATTGGTGGGATCGATGGGAAAAGGTTGGAGAAGAAGATTGAGAAGATAATTCATGAGATACCAAATCCAACTACGGATGAAGCAACTCGT
ACGGAGTGGGAAAAAGAGATCTGCCTGAAAATATTGAACTTGCACACTTCAACAAATGAGCGAACGGTGGCTTACGATGAGCTTTACCAA
AAGATCTTTGAGGTAACAGGGGTTCCAACAAGTATCACCGATGCAGGTTGCGCTTTGAATCCATTTTCTTTTCCATTCTTTACGGAGGCT
GGCATGCTTGGGCAATACATAGGTTTCGATCTTGATAAAGGTATGATCGAAGCGATCGAACACTCGTTGAGAACGCTTAACGCCCCAGAG
GGTATTGTTGTCAAACAGGGAGATATATTATCCGATCCGTCAGGCGAGAGTGATCTTCTACTTATGTTCAAGCTATATACTCTACTCGAT
CGGCAGGAAGAGGCCTCTGGTTTGAAAATTCTTCAAGAGTGGAAATACAAAAATGCTGTGATCTCTTTTCCTATTAAAACTATAAGTGGG
AGAGATGTTGGGATGGAAGAGAATTACACTGTTAAGTTCGAGAATGATCTTGTTGGGTCAGATCTGAGAATCATGCAAAAATTGAAATTA
GGAAACGAGATGTATTTTATCGTATCGAGATTGTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

rmtC

Prevalence: protein homolog model (view sequences)

Graph