OXA-2

Download Sequences

Accession	ARO:3001397
CARD Short Name	OXA-2
Definition	OXA-2 is a beta-lactamase found in the Enterobacteriaceae family.
AMR Gene Family	OXA beta-lactamase, OXA-2-like beta-lactamase
Drug Class	penam, cephalosporin, carbapenem
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Achromobacter xylosoxidans^wgs, Acinetobacter baumannii^g+p+wgs, Aeromonas caviae^g+wgs, Alcaligenes faecalis^g+gi, Burkholderia cenocepacia^wgs, Citrobacter freundii^wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^g+wgs+gi, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Pasteurella multocida^g+gi, Proteus mirabilis^wgs, Providencia rettgeri^g+p+wgs, Providencia stuartii^wgs, Pseudomonas aeruginosa^g+wgs+gi, Pseudomonas monteilii^wgs, Pseudomonas putida^wgs, Pseudomonas stutzeri^wgs, Salmonella enterica^p+wgs, Serratia marcescens^wgs, Shigella sonnei^wgs, Vibrio cholerae^wgs
Resistomes with Sequence Variants	Achromobacter xylosoxidans^wgs, Acinetobacter baumannii^g+p+wgs, Aeromonas caviae^g+wgs, Alcaligenes faecalis^g+gi, Burkholderia cenocepacia^wgs, Citrobacter freundii^wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^g+wgs+gi, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs, Klebsiella quasipneumoniae^p+wgs, Pasteurella multocida^g+gi, Proteus mirabilis^wgs, Providencia rettgeri^g+p+wgs, Providencia stuartii^wgs, Pseudomonas aeruginosa^g+wgs+gi, Pseudomonas monteilii^wgs, Pseudomonas putida^wgs, Pseudomonas stutzeri^wgs, Salmonella enterica^p+wgs, Serratia marcescens^wgs, Shigella sonnei^wgs, Vibrio cholerae^wgs
Classification	17 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + beta-lactam antibiotic + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + penam [Drug Class] + beta-lactamase + cephem + class D beta-lactamase + oxacillin [Antibiotic] + OXA beta-lactamase [AMR Gene Family] + cephalosporin [Drug Class] + carbapenem [Drug Class]
Parent Term(s)	5 ontology terms \| Show + confers_resistance_to_antibiotic ceftazidime [Antibiotic] + confers_resistance_to_antibiotic amoxicillin [Antibiotic] + confers_resistance_to_antibiotic meropenem [Antibiotic] + confers_resistance_to_antibiotic ampicillin [Antibiotic] + OXA-2-like beta-lactamase [AMR Gene Family]
Sub-Term(s)	2 ontology terms \| Show + tazobactam [Adjuvant] is_small_molecule_inhibitor + sulbactam [Adjuvant] is_small_molecule_inhibitor
Publications	Holland S and Dale JW. 1984. Biochem J 224(3): 1009-1013. Improved purification and characterization of the OXA-2 beta-lactamase. (PMID 6335398) Simo Tchuinte PL, et al. 2016. Int. J. Antimicrob. Agents : Characterisation of class 3 integrons with oxacillinase gene cassettes in hospital sewage and sludge samples from France and Luxembourg. (PMID 27499434)

Resistomes

Prevalence of OXA-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Achromobacter xylosoxidans	0%	0%	0.76%	0%
Achromobacter xylosoxidans	0%	0%	0.76%	0%
Acinetobacter baumannii	1.24%	0.05%	0.07%	0%
Acinetobacter baumannii	1.24%	0.05%	0.07%	0%
Aeromonas caviae	4.55%	0%	2.69%	0%
Aeromonas caviae	4.55%	0%	2.69%	0%
Alcaligenes faecalis	5%	0%	0%	33.33%
Alcaligenes faecalis	5%	0%	0%	33.33%
Burkholderia cenocepacia	0%	0%	0.22%	0%
Burkholderia cenocepacia	0%	0%	0.22%	0%
Citrobacter freundii	0%	0%	0.97%	0%
Citrobacter freundii	0%	0%	0.97%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Citrobacter werkmanii	0%	0%	5.13%	0%
Citrobacter werkmanii	0%	0%	5.13%	0%
Enterobacter asburiae	0%	0%	0.4%	0%
Enterobacter asburiae	0%	0%	0.4%	0%
Enterobacter cloacae	0%	0%	0.64%	0%
Enterobacter cloacae	0%	0%	0.64%	0%
Enterobacter hormaechei	0.72%	0%	0.43%	3.33%
Enterobacter hormaechei	0.72%	0%	0.43%	3.33%
Enterobacter kobei	0%	0.69%	0.87%	0%
Enterobacter kobei	0%	0.69%	0.87%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%
Enterobacter roggenkampii	0%	0%	0.36%	0%
Escherichia coli	0.07%	0.01%	0.08%	0%
Escherichia coli	0.07%	0.01%	0.07%	0%
Klebsiella aerogenes	0%	0%	0.56%	0%
Klebsiella aerogenes	0%	0%	0.56%	0%
Klebsiella michiganensis	0%	0%	0.8%	0%
Klebsiella michiganensis	0%	0%	0.8%	0%
Klebsiella oxytoca	0%	1.37%	0.42%	0%
Klebsiella oxytoca	0%	1.37%	0.42%	0%
Klebsiella pneumoniae	0.06%	0.05%	0.7%	0%
Klebsiella pneumoniae	0.06%	0.05%	0.68%	0%
Klebsiella quasipneumoniae	0%	0.64%	1.32%	0%
Klebsiella quasipneumoniae	0%	0.64%	1.32%	0%
Pasteurella multocida	3.57%	0%	0%	16.67%
Pasteurella multocida	3.57%	0%	0%	16.67%
Proteus mirabilis	0%	0%	0.17%	0%
Proteus mirabilis	0%	0%	0.17%	0%
Providencia rettgeri	2.94%	2.7%	7.64%	0%
Providencia rettgeri	2.94%	2.7%	7.64%	0%
Providencia stuartii	0%	0%	4.55%	0%
Providencia stuartii	0%	0%	4.55%	0%
Pseudomonas aeruginosa	1.69%	0%	1.54%	4.17%
Pseudomonas aeruginosa	1.84%	0%	1.57%	5.56%
Pseudomonas monteilii	0%	0%	4.76%	0%
Pseudomonas monteilii	0%	0%	4.76%	0%
Pseudomonas putida	0%	0%	1.6%	0%
Pseudomonas putida	0%	0%	1.6%	0%
Pseudomonas stutzeri	0%	0%	0.76%	0%
Pseudomonas stutzeri	0%	0%	0.76%	0%
Salmonella enterica	0%	0.05%	0.05%	0%
Salmonella enterica	0%	0.05%	0.05%	0%
Serratia marcescens	0%	0%	1.83%	0%
Serratia marcescens	0%	0%	1.83%	0%
Shigella sonnei	0%	0%	1.46%	0%
Shigella sonnei	0%	0%	1.46%	0%
Vibrio cholerae	0%	0%	0.06%	0%
Vibrio cholerae	0%	0%	0.06%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|CAA30246.1|+|OXA-2 [Salmonella enterica subsp. enterica serovar Typhimurium]
MAIRIFAILFSIFSLATFAHAQEGTLERSDWRKFFSEFQAKGTIVVADERQADRAMLVFDPVRSKKRYSPASTFKIPHTLFALDAGAVRD
EFQIFRWDGVNRGFAGHNQDQDLRSAMRNSTVWVYELFAKEIGDDKARRYLKKIDYGNADPSTSNGDYWIEGSLAISAQEQIAFLRKLYR
NELPFRVEHQRLVKDLMIVEAGRNWILRAKTGWEGRMGWWVGWVEWPTGSVFFALNIDTPNRMDDLFKREAIVRAILRSIEALPPNPAVN
SDAAR

>gb|X07260.1|+|701-1528|OXA-2 [Salmonella enterica subsp. enterica serovar Typhimurium]
ATGGCAATCCGAATCTTCGCGATACTTTTCTCCATTTTTTCTCTTGCCACTTTCGCGCATGCGCAAGAAGGCACGCTAGAACGTTCTGAC
TGGAGGAAGTTTTTCAGCGAATTTCAAGCCAAAGGCACGATAGTTGTGGCAGACGAACGCCAAGCGGATCGTGCCATGTTGGTTTTTGAT
CCTGTGCGATCGAAGAAACGCTACTCGCCTGCATCGACATTCAAGATACCTCATACACTTTTTGCACTTGATGCAGGCGCTGTTCGTGAT
GAGTTCCAGATTTTTCGATGGGACGGCGTTAACAGGGGCTTTGCAGGCCACAATCAAGACCAAGATTTGCGATCAGCAATGCGGAATTCT
ACTGTTTGGGTGTATGAGCTATTTGCAAAGGAAATTGGTGATGACAAAGCTCGGCGCTATTTGAAGAAAATCGACTATGGCAACGCCGAT
CCTTCGACAAGTAATGGCGATTACTGGATAGAAGGCAGCCTTGCAATCTCGGCGCAGGAGCAAATTGCATTTCTCAGGAAGCTCTATCGT
AACGAGCTGCCCTTTCGGGTAGAACATCAGCGCTTGGTCAAGGATCTCATGATTGTGGAAGCCGGTCGCAACTGGATACTGCGTGCAAAG
ACGGGCTGGGAAGGCCGTATGGGTTGGTGGGTAGGATGGGTTGAGTGGCCGACTGGCTCCGTATTCTTCGCACTGAATATTGATACGCCA
AACAGAATGGATGATCTTTTCAAGAGGGAGGCAATCGTGCGGGCAATCCTTCGCTCTATTGAAGCGTTACCGCCCAACCCGGCAGTCAAC
TCGGACGCTGCGCGATAA

OXA-2

Prevalence: protein homolog model (view sequences)

Graph