OXA-2

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3001397
CARD Short NameOXA-2
DefinitionOXA-2 is a beta-lactamase found in the Enterobacteriaceae family.
AMR Gene FamilyOXA-2-like beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONPseudomonas aeruginosa (10), Escherichia coli (6), Klebsiella pneumoniae (2), Proteus vulgaris (2), Staphylococcus aureus (2)
GAZ
FOODON
ENVO
UBERON
Classification18 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin [Antibiotic]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ OXA-2-like beta-lactamase [AMR Gene Family]
Sub-Term(s)
2 ontology terms | Show
+ tazobactam [Adjuvant] is_small_molecule_inhibitor_of
+ sulbactam [Adjuvant] is_small_molecule_inhibitor_of
Resistomes with Perfect MatchesAchromobacter xylosoxidanswgs, Acinetobacter baumanniig+p+wgs, Aeromonas caviaeg+wgs, Alcaligenes faecalisg+gi, Burkholderia cenocepaciawgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheig+wgs+gi, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Pasteurella multocidag+gi, Proteus mirabiliswgs, Providencia rettgerig+p+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+wgs+gi, Pseudomonas monteiliiwgs, Pseudomonas putidawgs, Salmonella entericap+wgs, Serratia marcescenswgs, Shigella sonneiwgs, Stutzerimonas stutzeriwgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAchromobacter xylosoxidanswgs, Acinetobacter baumanniig+p+wgs, Aeromonas caviaeg+wgs, Alcaligenes faecalisg+gi, Burkholderia cenocepaciawgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheig+wgs+gi, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Pasteurella multocidag+gi, Proteus mirabiliswgs, Providencia rettgerig+p+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+wgs+gi, Pseudomonas monteiliiwgs, Pseudomonas putidawgs, Salmonella entericap+wgs, Serratia marcescenswgs, Shigella sonneiwgs, Stutzerimonas stutzeriwgs, Vibrio choleraewgs
Publications

Holland S and Dale JW. 1984. Biochem J 224(3): 1009-1013. Improved purification and characterization of the OXA-2 beta-lactamase. (PMID 6335398)

Simo Tchuinte PL, et al. 2016. Int. J. Antimicrob. Agents : Characterisation of class 3 integrons with oxacillinase gene cassettes in hospital sewage and sludge samples from France and Luxembourg. (PMID 27499434)

Resistomes

Prevalence of OXA-2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Achromobacter xylosoxidans0%0%0.76%0%0%
Acinetobacter baumannii1.24%0.05%0.07%0%0%
Aeromonas caviae4.55%0%2.69%0%0%
Alcaligenes faecalis5%0%0%33.33%0%
Burkholderia cenocepacia0%0%0.22%0%0%
Citrobacter freundii0%0%1.35%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%0%1.8%0%0%
Citrobacter werkmanii0%0%5.13%0%0%
Enterobacter asburiae0%0%0.4%0%0%
Enterobacter cloacae0%0%0.64%0%0%
Enterobacter hormaechei0.72%0%0.43%3.33%0%
Enterobacter kobei0%0.69%0.87%0%0%
Enterobacter roggenkampii0%0%0.36%0%0%
Escherichia coli0.07%0.01%0.09%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella michiganensis0%0%0.8%0%0%
Klebsiella oxytoca0%1.37%0.42%0%0%
Klebsiella pneumoniae0.06%0.05%0.93%0%0%
Klebsiella quasipneumoniae0%0.64%1.58%0%0%
Pasteurella multocida3.57%0%0%16.67%0%
Proteus mirabilis0%0%0.17%0%0%
Providencia rettgeri2.94%2.7%7.64%0%0%
Providencia stuartii0%0%6.82%0%0%
Pseudomonas aeruginosa1.84%0%2.14%5.56%0%
Pseudomonas monteilii0%0%7.14%0%0%
Pseudomonas putida0%0%1.6%0%0%
Salmonella enterica0%0.05%0.05%0%0%
Serratia marcescens0%0%2.75%0%0%
Shigella sonnei0%0%1.46%0%0%
Stutzerimonas stutzeri0%0%0.76%0%0%
Vibrio cholerae0%0%0.06%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|CAA30246.1|+|OXA-2 [Salmonella enterica subsp. enterica serovar Typhimurium]
MAIRIFAILFSIFSLATFAHAQEGTLERSDWRKFFSEFQAKGTIVVADERQADRAMLVFDPVRSKKRYSPASTFKIPHTLFALDAGAVRD
EFQIFRWDGVNRGFAGHNQDQDLRSAMRNSTVWVYELFAKEIGDDKARRYLKKIDYGNADPSTSNGDYWIEGSLAISAQEQIAFLRKLYR
NELPFRVEHQRLVKDLMIVEAGRNWILRAKTGWEGRMGWWVGWVEWPTGSVFFALNIDTPNRMDDLFKREAIVRAILRSIEALPPNPAVN
SDAAR


>gb|X07260.1|+|701-1528|OXA-2 [Salmonella enterica subsp. enterica serovar Typhimurium]
ATGGCAATCCGAATCTTCGCGATACTTTTCTCCATTTTTTCTCTTGCCACTTTCGCGCATGCGCAAGAAGGCACGCTAGAACGTTCTGAC
TGGAGGAAGTTTTTCAGCGAATTTCAAGCCAAAGGCACGATAGTTGTGGCAGACGAACGCCAAGCGGATCGTGCCATGTTGGTTTTTGAT
CCTGTGCGATCGAAGAAACGCTACTCGCCTGCATCGACATTCAAGATACCTCATACACTTTTTGCACTTGATGCAGGCGCTGTTCGTGAT
GAGTTCCAGATTTTTCGATGGGACGGCGTTAACAGGGGCTTTGCAGGCCACAATCAAGACCAAGATTTGCGATCAGCAATGCGGAATTCT
ACTGTTTGGGTGTATGAGCTATTTGCAAAGGAAATTGGTGATGACAAAGCTCGGCGCTATTTGAAGAAAATCGACTATGGCAACGCCGAT
CCTTCGACAAGTAATGGCGATTACTGGATAGAAGGCAGCCTTGCAATCTCGGCGCAGGAGCAAATTGCATTTCTCAGGAAGCTCTATCGT
AACGAGCTGCCCTTTCGGGTAGAACATCAGCGCTTGGTCAAGGATCTCATGATTGTGGAAGCCGGTCGCAACTGGATACTGCGTGCAAAG
ACGGGCTGGGAAGGCCGTATGGGTTGGTGGGTAGGATGGGTTGAGTGGCCGACTGGCTCCGTATTCTTCGCACTGAATATTGATACGCCA
AACAGAATGGATGATCTTTTCAAGAGGGAGGCAATCGTGCGGGCAATCCTTCGCTCTATTGAAGCGTTACCGCCCAACCCGGCAGTCAAC
TCGGACGCTGCGCGATAA

Curator Acknowledgements
Curator Description Most Recent Edit