OXA-48

Download Sequences

Accession	ARO:3001782
CARD Short Name	OXA-48
Definition	OXA-48 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene Family	OXA beta-lactamase, OXA-48-like beta-lactamase
Drug Class	penam, carbapenem
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Citrobacter amalonaticus^wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^p+wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter asburiae^wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^wgs, Proteus mirabilis^g+wgs, Raoultella planticola^wgs, Salmonella enterica^p, Serratia marcescens^p+wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^p+wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter asburiae^wgs, Enterobacter chengduensis^wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^g+p+wgs, Klebsiella aerogenes^p+wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p+wgs, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^wgs, Proteus mirabilis^g+wgs, Raoultella planticola^wgs, Salmonella enterica^p, Serratia marcescens^p+wgs
Classification	15 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic inactivation [Resistance Mechanism] + hydrolysis of antibiotic conferring resistance + antibiotic inactivation enzyme + beta-lactam antibiotic + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactamase + penam [Drug Class] + class D beta-lactamase + oxacillin [Antibiotic] + OXA beta-lactamase [AMR Gene Family] + carbapenem [Drug Class]
Parent Term(s)	2 ontology terms \| Show + OXA-48-like beta-lactamase [AMR Gene Family] + confers_resistance_to_antibiotic temocillin [Antibiotic]
Sub-Term(s)	3 ontology terms \| Show + ANT3310 [Adjuvant] is_small_molecule_inhibitor + Xeruborbactam [Adjuvant] is_small_molecule_inhibitor + taniborbactam [Adjuvant] is_small_molecule_inhibitor
Publications	Poirel L, et al. 2003. Antimicrob Agents Chemother 48(1): 15-22. Emergence of oxacillinase-mediated resistance to imipenem in Klebsiella pneumoniae. (PMID 14693513)

Resistomes

Prevalence of OXA-48 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Citrobacter amalonaticus	0%	0%	1.82%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%
Citrobacter freundii	0%	1.54%	7.16%	0%
Citrobacter freundii	0%	1.54%	7.35%	0%
Citrobacter koseri	0%	10%	3.6%	0%
Citrobacter koseri	0%	10%	3.6%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Enterobacter asburiae	0%	0%	0.79%	0%
Enterobacter asburiae	0%	0%	0.79%	0%
Enterobacter chengduensis	0%	0%	4%	0%
Enterobacter chengduensis	0%	0%	4%	0%
Enterobacter cloacae	0%	1.12%	2.56%	0%
Enterobacter cloacae	0%	1.12%	2.56%	0%
Enterobacter hormaechei	0%	0.58%	1.73%	0%
Enterobacter hormaechei	0%	0.58%	1.73%	0%
Enterobacter kobei	0%	0%	0.44%	0%
Enterobacter kobei	0%	0%	0.44%	0%
Enterobacter roggenkampii	0%	0.48%	1.44%	0%
Enterobacter roggenkampii	0%	0.48%	1.44%	0%
Escherichia coli	0.81%	0.24%	0.41%	0%
Escherichia coli	0.81%	0.24%	0.41%	0%
Klebsiella aerogenes	0%	1.09%	3.11%	0%
Klebsiella aerogenes	0%	1.09%	3.11%	0%
Klebsiella michiganensis	0%	1.14%	0.8%	0%
Klebsiella michiganensis	0%	1.14%	0.8%	0%
Klebsiella oxytoca	0%	4.11%	0.84%	0%
Klebsiella oxytoca	0%	4.11%	0.84%	0%
Klebsiella pneumoniae	0.53%	1.53%	3.96%	0.95%
Klebsiella pneumoniae	0.53%	1.55%	3.98%	0.95%
Klebsiella quasipneumoniae	0%	0%	1.05%	0%
Klebsiella quasipneumoniae	0%	0%	1.05%	0%
Proteus mirabilis	1.83%	0%	0.17%	0%
Proteus mirabilis	1.83%	0%	0.17%	0%
Raoultella planticola	0%	0%	2.56%	0%
Raoultella planticola	0%	0%	2.56%	0%
Salmonella enterica	0%	0.33%	0%	0%
Salmonella enterica	0%	0.33%	0%	0%
Serratia marcescens	0%	0.65%	2.75%	0%
Serratia marcescens	0%	0.65%	2.75%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500

Protein
DNA

>gb|AAP70012.1|+|OXA-48 [Klebsiella pneumoniae]
MRVLALSAVFLVASIIGMPAVAKEWQENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLKRANQAFLPASTFKIPNSLIALDLGVVKDEH
QVFKWDGQTRDIATWNRDHNLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYGNEDISGNVDSFWLDGGIRISATEQISFLRKLYHNK
LHVSERSQRIVKQAMLTEANGDYIIRAKTGYSTRIEPKIGWWVGWVELDDNVWFFAMNMDMPTSDGLGLRQAITKEVLKQEKIIP

>gb|AY236073.2|+|2188-2985|OXA-48 [Klebsiella pneumoniae]
ATGCGTGTATTAGCCTTATCGGCTGTGTTTTTGGTGGCATCGATTATCGGAATGCCTGCGGTAGCAAAGGAATGGCAAGAAAACAAAAGT
TGGAATGCTCACTTTACTGAACATAAATCACAGGGCGTAGTTGTGCTCTGGAATGAGAATAAGCAGCAAGGATTTACCAATAATCTTAAA
CGGGCGAACCAAGCATTTTTACCCGCATCTACCTTTAAAATTCCCAATAGCTTGATCGCCCTCGATTTGGGCGTGGTTAAGGATGAACAC
CAAGTCTTTAAGTGGGATGGACAGACGCGCGATATCGCCACTTGGAATCGCGATCATAATCTAATCACCGCGATGAAATATTCAGTTGTG
CCTGTTTATCAAGAATTTGCCCGCCAAATTGGCGAGGCACGTATGAGCAAGATGCTACATGCTTTCGATTATGGTAATGAGGACATTTCG
GGCAATGTAGACAGTTTCTGGCTCGACGGTGGTATTCGAATTTCGGCCACGGAGCAAATCAGCTTTTTAAGAAAGCTGTATCACAATAAG
TTACACGTATCGGAGCGCAGCCAGCGTATTGTCAAACAAGCCATGCTGACCGAAGCCAATGGTGACTATATTATTCGGGCTAAAACTGGA
TACTCGACTAGAATCGAACCTAAGATTGGCTGGTGGGTCGGTTGGGTTGAACTTGATGATAATGTGTGGTTTTTTGCGATGAATATGGAT
ATGCCCACATCGGATGGTTTAGGGCTGCGCCAAGCCATCACAAAAGAAGTGCTCAAACAGGAAAAAATTATTCCCTAG

OXA-48

Prevalence: protein homolog model (view sequences)

Graph