KPC-3

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002313
CARD Short NameKPC-3
DefinitionKPC-3 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene FamilyKPC beta-lactamase
Drug Classpenicillin beta-lactam, cephalosporin, carbapenem, monobactam
Resistance Mechanismantibiotic inactivation
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONKlebsiella pneumoniae (95), Escherichia coli (20), Enterobacter cloacae (7), Enterobacteriaceae (5), Acinetobacter baumannii (5), Citrobacter freundii (4), Enterobacter (3), Klebsiella oxytoca (2), Klebsiella (2), Enterobacterales (2)
GAZItaly (6), Israel (6), Kingdom of Spain (6), City of New York Mills (3), New York City (3), Greece (2), China (2), Europe (2), Unity State (2)
FOODON
ENVOhospital (14)
UBERON
Classification15 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ KPC beta-lactamase [AMR Gene Family]
Sub-Term(s)
5 ontology terms | Show
+ avibactam [Adjuvant] is_small_molecule_inhibitor_of
+ relebactam [Adjuvant] is_small_molecule_inhibitor_of
+ vaborbactam [Adjuvant] is_small_molecule_inhibitor_of
+ ARX1796 [Adjuvant] is_small_molecule_inhibitor_of
+ KPC-125 evolutionary_variant_of
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colip+wgs, Escherichia marmotaewgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Proteus mirabiliswgs, Pseudomonas aeruginosag+p+wgs, Raoultella planticolap+wgs, Serratia marcescensg+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colip+wgs, Escherichia marmotaewgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Proteus mirabiliswgs, Pseudomonas aeruginosag+p+wgs, Raoultella planticolap+wgs, Serratia marcescensg+wgs
Publications

Wolter DJ, et al. 2009. Antimicrob Agents Chemother 53(2): 557-562. Phenotypic and enzymatic comparative analysis of the novel KPC variant KPC-5 and its evolutionary variants, KPC-2 and KPC-4. (PMID 19015357)

Resistomes

Prevalence of KPC-3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.01%0%0%
Citrobacter freundii0%0.31%4.84%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%0%0.9%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Enterobacter asburiae0%0.28%2.37%0%0%
Enterobacter cloacae0%1.12%0.64%0%0%
Enterobacter hormaechei0.36%0.39%6.82%0%0%
Enterobacter kobei0%1.38%1.31%0%0%
Enterobacter roggenkampii0%0.48%0.72%0%0%
Escherichia coli0%0.11%0.13%0%0%
Escherichia marmotae0%0%2.08%0%0%
Klebsiella aerogenes0%0%2.54%0%0%
Klebsiella michiganensis0%0.57%2.13%0%0%
Klebsiella oxytoca0%2.05%0%0%0%
Klebsiella pneumoniae0.24%1.31%10.63%0.95%0%
Klebsiella quasipneumoniae0%0%0.53%0%0%
Proteus mirabilis0%0%0.33%0%0%
Pseudomonas aeruginosa0.15%0.29%0.07%0%0%
Raoultella planticola0%4.65%2.56%0%0%
Serratia marcescens1.52%0%2.75%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550


>gb|AAL05630.1|+|KPC-3 [Klebsiella pneumoniae]
MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLL
DTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTS
SPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDD
KYSEAVIAAAARLALEGLGVNGQ


>gb|AF395881.1|+|1-882|KPC-3 [Klebsiella pneumoniae]
ATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCTGGCTTTTCTGCCACCGCGCTGACCAACCTCGTCGCG
GAACCATTCGCTAAACTCGAACAGGACTTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGTTACCGC
GCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCTGTGCTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTG
GACACACCCATCCGTTACGGCAAAAATGCGCTGGTTCCGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTGGCGGAG
CTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTGAAGGAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTC
ATGCGCTCTATCGGCGATACCACGTTCCGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGATACCTCA
TCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTGGCTGCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTA
AAGGGAAACACGACCGGCAACCACCGCATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGAGTGTAT
GGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTGTTGGCCGTCTACACCCGGGCGCCTAACAAGGATGAC
AAGTACAGCGAGGCCGTCATCGCCGCTGCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGGCAGTAA

Curator Acknowledgements
Curator Description Most Recent Edit