KPC-3

Download Sequences

Accession	ARO:3002313
CARD Short Name	KPC-3
Definition	KPC-3 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene Family	KPC beta-lactamase
Drug Class	penicillin beta-lactam, cephalosporin, carbapenem, monobactam
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Acinetobacter baumannii^wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter asburiae^p+wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^p+wgs, Escherichia marmotae^wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^wgs, Proteus mirabilis^wgs, Pseudomonas aeruginosa^g+p+wgs, Raoultella planticola^p+wgs, Serratia marcescens^g+wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^wgs, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter asburiae^p+wgs, Enterobacter cloacae^p+wgs, Enterobacter hormaechei^g+p+wgs, Enterobacter kobei^p+wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^p+wgs, Escherichia marmotae^wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^p, Klebsiella pneumoniae^g+p+wgs+gi, Klebsiella quasipneumoniae^wgs, Proteus mirabilis^wgs, Pseudomonas aeruginosa^g+p+wgs, Raoultella planticola^p+wgs, Serratia marcescens^g+wgs
Classification	15 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + antibiotic inactivation enzyme + hydrolysis of antibiotic conferring resistance + antibiotic molecule + hydrolysis of beta-lactam antibiotic by serine beta-lactamase + beta-lactam antibiotic + beta-lactamase + class A beta-lactamase + penicillin beta-lactam [Drug Class] + cephalosporin [Drug Class] + carbapenem [Drug Class] + monobactam [Drug Class]
Parent Term(s)	1 ontology terms \| Show + KPC beta-lactamase [AMR Gene Family]
Sub-Term(s)	5 ontology terms \| Show + avibactam [Adjuvant] is_small_molecule_inhibitor + relebactam [Adjuvant] is_small_molecule_inhibitor + vaborbactam [Adjuvant] is_small_molecule_inhibitor + ARX1796 [Adjuvant] is_small_molecule_inhibitor + KPC-125 evolutionary_variant_of
Publications	Wolter DJ, et al. 2009. Antimicrob Agents Chemother 53(2): 557-562. Phenotypic and enzymatic comparative analysis of the novel KPC variant KPC-5 and its evolutionary variants, KPC-2 and KPC-4. (PMID 19015357)

Resistomes

Prevalence of KPC-3 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Acinetobacter baumannii	0%	0%	0.01%	0%	0%
Acinetobacter baumannii	0%	0%	0.01%	0%	0%
Citrobacter freundii	0%	0.31%	4.84%	0%	0%
Citrobacter freundii	0%	0.31%	4.84%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Enterobacter asburiae	0%	0.28%	2.37%	0%	0%
Enterobacter asburiae	0%	0.28%	2.37%	0%	0%
Enterobacter cloacae	0%	1.12%	0.64%	0%	0%
Enterobacter cloacae	0%	1.12%	0.64%	0%	0%
Enterobacter hormaechei	0.36%	0.39%	6.82%	0%	0%
Enterobacter hormaechei	0.36%	0.39%	6.82%	0%	0%
Enterobacter kobei	0%	1.38%	1.31%	0%	0%
Enterobacter kobei	0%	1.38%	1.31%	0%	0%
Enterobacter roggenkampii	0%	0.48%	0.72%	0%	0%
Enterobacter roggenkampii	0%	0.48%	0.72%	0%	0%
Escherichia coli	0%	0.11%	0.13%	0%	0%
Escherichia coli	0%	0.11%	0.13%	0%	0%
Escherichia marmotae	0%	0%	2.08%	0%	0%
Escherichia marmotae	0%	0%	2.08%	0%	0%
Klebsiella aerogenes	0%	0%	2.54%	0%	0%
Klebsiella aerogenes	0%	0%	2.54%	0%	0%
Klebsiella michiganensis	0%	0.57%	2.13%	0%	0%
Klebsiella michiganensis	0%	0.57%	2.13%	0%	0%
Klebsiella oxytoca	0%	2.05%	0%	0%	0%
Klebsiella oxytoca	0%	2.05%	0%	0%	0%
Klebsiella pneumoniae	0.24%	1.31%	10.63%	0.95%	0%
Klebsiella pneumoniae	0.24%	1.31%	10.61%	0.95%	0%
Klebsiella quasipneumoniae	0%	0%	0.53%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.53%	0%	0%
Proteus mirabilis	0%	0%	0.33%	0%	0%
Proteus mirabilis	0%	0%	0.33%	0%	0%
Pseudomonas aeruginosa	0.15%	0.29%	0.07%	0%	0%
Pseudomonas aeruginosa	0.15%	0.29%	0.07%	0%	0%
Raoultella planticola	0%	4.65%	2.56%	0%	0%
Raoultella planticola	0%	4.65%	2.56%	0%	0%
Serratia marcescens	1.52%	0%	2.75%	0%	0%
Serratia marcescens	1.52%	0%	2.75%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550

Protein
DNA

>gb|AAL05630.1|+|KPC-3 [Klebsiella pneumoniae]
MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLL
DTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTS
SPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDD
KYSEAVIAAAARLALEGLGVNGQ

>gb|AF395881.1|+|1-882|KPC-3 [Klebsiella pneumoniae]
ATGTCACTGTATCGCCGTCTAGTTCTGCTGTCTTGTCTCTCATGGCCGCTGGCTGGCTTTTCTGCCACCGCGCTGACCAACCTCGTCGCG
GAACCATTCGCTAAACTCGAACAGGACTTTGGCGGCTCCATCGGTGTGTACGCGATGGATACCGGCTCAGGCGCAACTGTAAGTTACCGC
GCTGAGGAGCGCTTCCCACTGTGCAGCTCATTCAAGGGCTTTCTTGCTGCCGCTGTGCTGGCTCGCAGCCAGCAGCAGGCCGGCTTGCTG
GACACACCCATCCGTTACGGCAAAAATGCGCTGGTTCCGTGGTCACCCATCTCGGAAAAATATCTGACAACAGGCATGACGGTGGCGGAG
CTGTCCGCGGCCGCCGTGCAATACAGTGATAACGCCGCCGCCAATTTGTTGCTGAAGGAGTTGGGCGGCCCGGCCGGGCTGACGGCCTTC
ATGCGCTCTATCGGCGATACCACGTTCCGTCTGGACCGCTGGGAGCTGGAGCTGAACTCCGCCATCCCAGGCGATGCGCGCGATACCTCA
TCGCCGCGCGCCGTGACGGAAAGCTTACAAAAACTGACACTGGGCTCTGCACTGGCTGCGCCGCAGCGGCAGCAGTTTGTTGATTGGCTA
AAGGGAAACACGACCGGCAACCACCGCATCCGCGCGGCGGTGCCGGCAGACTGGGCAGTCGGAGACAAAACCGGAACCTGCGGAGTGTAT
GGCACGGCAAATGACTATGCCGTCGTCTGGCCCACTGGGCGCGCACCTATTGTGTTGGCCGTCTACACCCGGGCGCCTAACAAGGATGAC
AAGTACAGCGAGGCCGTCATCGCCGCTGCGGCTAGACTCGCGCTCGAGGGATTGGGCGTCAACGGGCAGTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

KPC-3

Prevalence: protein homolog model (view sequences)

Graph