AAC(6')-31

Accession ARO:3002585
CARD Short NameAAC(6')-31
DefinitionAAC(6')-31 is an integron-encoded aminoglycoside acetyltransferase in Pseudomonas putida, A. baumannii and K. pneumoniae.
AMR Gene FamilyAAC(6')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Acinetobacter radioresistenswgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaep, Pseudomonas aeruginosawgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Acinetobacter radioresistenswgs, Alcaligenes faecalisg, Citrobacter freundiip, Citrobacter portucalensiswgs, Enterobacter hormaecheiwgs, Enterobacter roggenkampiip, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaep, Pseudomonas aeruginosawgs, Stenotrophomonas maltophiliawgs
Classification9 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ confers_resistance_to_antibiotic neomycin [Antibiotic]
+ confers_resistance_to_antibiotic amikacin [Antibiotic]
+ confers_resistance_to_antibiotic sisomicin [Antibiotic]
+ confers_resistance_to_antibiotic netilmicin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ AAC(6') [AMR Gene Family]
+ confers_resistance_to_antibiotic isepamicin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin A [Antibiotic]
Publications

Mendes RE, et al. 2007. Antimicrob Agents Chemother 51(7): 2611-2614. Characterization of an integron carrying blaIMP-1 and a new aminoglycoside resistance gene, aac(6')-31, and its dissemination among genetically unrelated clinical isolates in a Brazilian hospital. (PMID 17470660)

Resistomes

Prevalence of AAC(6')-31 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.02%0%
Acinetobacter nosocomialis0%0%1.3%0%
Acinetobacter pittii0%0%1.32%0%
Acinetobacter radioresistens0%0%2.44%0%
Alcaligenes faecalis6.25%0%0%0%
Citrobacter freundii0%0.32%0%0%
Citrobacter portucalensis0%0%1.72%0%
Enterobacter hormaechei0%0%0.05%0%
Enterobacter roggenkampii0%0.55%0%0%
Escherichia coli0%0%0%0%
Klebsiella pneumoniae0%0%0.03%0%
Klebsiella quasipneumoniae0%1.35%0%0%
Pseudomonas aeruginosa0%0%0.55%0%
Stenotrophomonas maltophilia0%0%0.17%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 325


>gb|CAK55557.1|+|AAC(6')-31 [Pseudomonas putida]
MTEHDLPMLHDWLNRPHIVEWWGGEETRPTLAEVLEQYLPSALAKESVTPYIAMLDEEPIGYAQSYIALGSGDGWWEDETDPGVRGIDQS
LANPSQLGKGLGTKLVCALVEMLFKDAEVTKIQTDPSPNNLRAIRCYEKAGFVAQRTINTPDGPAVYMVQTRQAFEQARSAV


>gb|AM283489.1|+|2656-3174|AAC(6')-31 [Pseudomonas putida]
ATGACCGAGCACGACCTTCCGATGCTCCATGACTGGCTAAATCGGCCTCACATCGTTGAGTGGTGGGGCGGAGAAGAAACACGTCCAACA
CTTGCTGAAGTGCTGGAGCAATACCTACCAAGCGCCCTGGCGAAAGAGTCCGTCACTCCCTACATCGCAATGCTGGATGAAGAACCGATT
GGGTACGCTCAGTCGTACATTGCACTCGGAAGCGGTGACGGATGGTGGGAAGACGAAACCGATCCAGGAGTACGCGGAATAGACCAGTCT
CTGGCGAATCCATCGCAGCTGGGCAAGGGCTTGGGAACCAAGCTCGTTTGCGCGCTCGTTGAGATGCTGTTCAAAGACGCTGAGGTAACC
AAGATCCAAACGGACCCGTCGCCGAACAACTTACGCGCAATCCGGTGCTACGAGAAGGCGGGTTTTGTGGCGCAAAGAACCATAAACACC
CCAGATGGACCGGCCGTATACATGGTTCAAACACGTCAGGCGTTCGAGCAGGCGCGCAGTGCTGTCTAA