APH(3')-IIIa

Download Sequences


Accession ARO:3002647
DefinitionAPH(3')-IIIa is a plasmid-encoded aminoglycoside phosphotransferase in S. aureus and Enterococcus spp.
AMR Gene FamilyAPH(3')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesCampylobacter colig+p+wgs, Campylobacter jejunig+p+wgs, Clostridioides difficileg+wgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+p+wgs, Escherichia colip, Helicobacter pylorig+wgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaewgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidisp+wgs, Staphylococcus pseudintermediusg+wgs, Streptococcus agalactiaeg+wgs, Streptococcus pneumoniaeg+wgs, Streptococcus pyogenesg+wgs
Resistomes with Sequence VariantsCampylobacter colig+p+wgs, Campylobacter jejunig+p+wgs, Clostridioides difficileg+wgs, Enterococcus faecalisg+p+wgs, Enterococcus faeciumg+p+wgs, Escherichia colig+p+wgs, Helicobacter pylorig+wgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaewgs, Mycobacterium tuberculosiswgs, Salmonella entericawgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidisp+wgs, Staphylococcus pseudintermediusg+wgs, Stenotrophomonas maltophiliawgs, Streptococcus agalactiaeg+wgs, Streptococcus pneumoniaeg+wgs, Streptococcus pyogenesg+wgs
Classification12 ontology terms | Show
Parent Term(s)9 ontology terms | Show
+ APH(3') [AMR Gene Family]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ confers_resistance_to_antibiotic butirosin [Antibiotic]
+ confers_resistance_to_antibiotic lividomycin B [Antibiotic]
+ confers_resistance_to_antibiotic lividomycin A [Antibiotic]
+ confers_resistance_to_antibiotic ribostamycin [Antibiotic]
+ confers_resistance_to_antibiotic paromomycin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic plazomicin [Antibiotic]
Publications

Trieu-Cuot P and Courvalin P. 1983. Gene 23(3): 331-341. Nucleotide sequence of the Streptococcus faecalis plasmid gene encoding the 3'5-aminoglycoside phosphotransferase type III. (PMID 6313476)

Resistomes

Prevalence of APH(3')-IIIa among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Campylobacter coli5.56%13.43%10.62%
Campylobacter jejuni0.57%12.94%4%
Clostridioides difficile3.08%0%2.6%
Enterococcus faecalis1.69%10.32%23.01%
Enterococcus faecium1.99%13.77%45.17%
Escherichia coli0.7%0.01%0.02%
Helicobacter pylori0.86%0%0.57%
Klebsiella aerogenes0%0%0.47%
Klebsiella pneumoniae0%0%0.07%
Mycobacterium tuberculosis0%0%0.02%
Salmonella enterica0%0%0.02%
Staphylococcus aureus7.88%3.19%22.75%
Staphylococcus epidermidis0%2.94%3.98%
Staphylococcus pseudintermedius40%0%73.02%
Stenotrophomonas maltophilia0%0%0.26%
Streptococcus agalactiae3.26%0%8.16%
Streptococcus pneumoniae3.17%0%0.66%
Streptococcus pyogenes1.46%0%1.37%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AGV10830.1|+|APH(3')-IIIa [Campylobacter coli CVM N29710]
MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKMTDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLM
SEADGVLCSEEYEDEQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDTPFKDPRELYDFLKTEKP
EEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF


>gb|CP004067|+|52915-53709|APH(3')-IIIa [Campylobacter coli CVM N29710]
ATGGCTAAAATGAGAATATCACCGGAATTGAAAAAACTGATCGAAAAATACCGCTGCGTAAAAGATACGGAAGGAATGTCTCCTGCTAAG
GTATATAAGCTGGTGGGAGAAAATGAAAACCTATATTTAAAAATGACGGACAGCCGGTATAAAGGGACCACCTATGATGTGGAACGGGAA
AAGGACATGATGCTATGGCTGGAAGGAAAGCTGCCTGTTCCAAAGGTCCTGCACTTTGAACGGCATGATGGCTGGAGCAATCTGCTCATG
AGTGAGGCCGATGGCGTCCTTTGCTCGGAAGAGTATGAAGATGAACAAAGCCCTGAAAAGATTATCGAGCTGTATGCGGAGTGCATCAGG
CTCTTTCACTCCATCGACATATCGGATTGTCCCTATACGAATAGCTTAGACAGCCGCTTAGCCGAATTGGATTACTTACTGAATAACGAT
CTGGCCGATGTGGATTGCGAAAACTGGGAAGAAGACACTCCATTTAAAGATCCGCGCGAGCTGTATGATTTTTTAAAGACGGAAAAGCCC
GAAGAGGAACTTGTCTTTTCCCACGGCGACCTGGGAGACAGCAACATCTTTGTGAAAGATGGCAAAGTAAGTGGCTTTATTGATCTTGGG
AGAAGCGGCAGGGCGGACAAGTGGTATGACATTGCCTTCTGCGTCCGGTCGATCAGGGAGGATATCGGGGAAGAACAGTATGTCGAGCTA
TTTTTTGACTTACTGGGGATCAAGCCTGATTGGGAGAAAATAAAATATTATATTTTACTGGATGAATTGTTTTAG