NmcA

Accession ARO:3003589
DefinitionNmcA is a class A serine beta-lactamase isolated from Enterobacter cloacae.
AMR Gene FamilyNmcA beta-lactamase
Drug Classpenam, cephamycin, carbapenem, cephalosporin
Resistance Mechanismantibiotic inactivation
ResistomesEnterobacter asburiaewgs, Enterobacter cloacaewgs, Klebsiella aerogeneswgs
Classification21 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ confers_resistance_to_antibiotic cefazolin [Antibiotic]
+ confers_resistance_to_antibiotic ampicillin [Antibiotic]
+ confers_resistance_to_antibiotic amoxicillin-clavulanic acid [Antibiotic]
+ NmcA beta-lactamase [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ NmcR regulates
Publications

Naas T, et al. 1994. Proc Natl Acad Sci U S A 91(16): 7693-7697. Analysis of a carbapenem-hydrolyzing class A beta-lactamase from Enterobacter cloacae and of its LysR-type regulatory protein. (PMID 8052644)

Resistomes

Prevalence of NmcA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterobacter asburiae0%0%1.19%
Enterobacter cloacae0%0%0.2%
Escherichia coli0.04%0%0%
Klebsiella aerogenes0%0%0.47%
Klebsiella pneumoniae0%0%0.02%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 575


>gb|CAA79967.1|+|NmcA beta-lactamase [Enterobacter cloacae]
MSLNVKQSRIAILFSSCLISISFFSQANTKGIDEIKNLETDFNGRIGVYALDTGSGKSFSYRANERFPLCSSFKGFLAAAVLKGSQDNRL
NLNQIVNYNTRSLEFHSPITTKYKDNGMSLGDMAAAALQYSDNGATNIILERYIGGPEGMTKFMRSIGDEDFRLDRWELDLNTAIPGDER
DTSTPAAVAKSLKTLALGNILSEHEKETYQTWLKGNTTGAARIRASVPSDWVVGDKTGSCGAYGTANDYAVVWPKNRAPLIISVYTTKNE
KEAKHEDKVIAEASRIAIDNLK


>gb|Z21956|+|1221-2099|NmcA beta-lactamase [Enterobacter cloacae]
ATGTCACTTAATGTAAAGCAAAGTAGAATAGCCATCTTGTTTAGCTCTTGTTTAATTTCAATATCATTTTTCTCACAGGCCAATACGAAG
GGCATTGATGAGATTAAAAACCTTGAAACAGATTTCAATGGCAGGATTGGTGTCTACGCTTTAGACACTGGCTCGGGTAAATCATTTTCG
TACAGAGCAAATGAACGATTTCCATTATGTAGTTCTTTTAAAGGTTTTTTAGCTGCTGCTGTATTAAAAGGCTCTCAAGATAATCGACTT
AATCTTAATCAGATTGTGAATTATAATACAAGAAGTTTAGAGTTCCATTCACCCATCACAACTAAATATAAAGATAATGGAATGTCATTA
GGTGATATGGCTGCTGCTGCTTTACAATATAGCGACAATGGTGCTACTAATATTATTCTTGAACGTTATATCGGTGGTCCAGAGGGTATG
ACTAAATTCATGCGGTCGATTGGAGATGAAGATTTTAGACTCGATCGTTGGGAGTTAGATCTAAACACAGCTATTCCAGGCGATGAGCGT
GACACATCTACACCTGCAGCAGTAGCCAAGAGTCTGAAAACCCTTGCTCTGGGTAACATACTTAGTGAACATGAAAAGGAAACCTATCAG
ACATGGTTAAAGGGTAACACAACCGGTGCAGCGCGTATTCGTGCTAGCGTACCAAGCGATTGGGTAGTTGGCGATAAAACTGGTAGTTGC
GGAGCATACGGTACGGCAAATGATTATGCGGTAGTCTGGCCAAAGAACCGGGCTCCTCTTATAATTTCTGTATACACAACAAAAAACGAA
AAAGAAGCCAAGCATGAGGATAAAGTAATCGCAGAAGCTTCAAGAATTGCAATTGATAACCTTAAATAA