gadW

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003838
Synonym(s)YhiW
CARD Short NamegadW
DefinitionGadW is an AraC-family regulator that promotes mdtEF expression to confer multidrug resistance. GadW inhibits GadX-dependent activation. GadW clearly represses gadX and, in situations where GadX is missing, activates gadA and gadBC.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classpenicillin beta-lactam, fluoroquinolone antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification17 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ regulates MdtEF-TolC
+ antibiotic efflux regulatory protein [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ gadX regulates
Resistomes with Perfect MatchesEnterobacter hormaecheiwgs, Escherichia colig+wgs, Shigella flexnerig, Shigella sonneiwgs
Resistomes with Sequence VariantsEnterobacter hormaecheiwgs, Escherichia colig+wgs, Shigella flexnerig, Shigella sonneiwgs
Publications

Ma Z, et al. 2002. J. Bacteriol. 184(24):7001-12 Collaborative regulation of Escherichia coli glutamate-dependent acid resistance by two AraC-like regulators, GadX and GadW (YhiW). (PMID 12446650)

Tramonti A, et al. 2006. J. Bacteriol. 188(23):8118-27 Mechanisms of transcription activation exerted by GadX and GadW at the gadA and gadBC gene promoters of the glutamate-based acid resistance system in Escherichia coli. (PMID 16980449)

Resistomes

Prevalence of gadW among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Enterobacter hormaechei0%0%0.04%0%0%
Escherichia coli10.72%0%18.7%0%3.01%
Shigella flexneri1%0%0%0%0%
Shigella sonnei0%0%0.07%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 470


>gb|ANK04027.1|-|gadW [Escherichia coli O25b:H4]
MAHVCSVILVRRSFDIHHEQQKISLHNESILLLDKNLADDFAFCSLDTRRLDIEELTVCHYLQNIRQLPRNLGLHSKDRLLINQSPPIQL
VTAIFDSFNDPRVNSPILSKMLYLSCLSMFSHKKELIPLLFNSISTVSGKVERLISFDIAKRWYLRDIAERMYTSESLIKKKLQDENTCF
SKILLASRMSMARRLLELRQIPLHTIAEKCGYSSTSYFINTFRQYYGVTPHQFSQHSPGTFS


>gb|CP015085.1|-|2551712-2552440|gadW [Escherichia coli O25b:H4]
ATGGCTCATGTCTGCTCGGTGATCCTCGTTCGTCGTTCATTCGATATTCATCATGAACAGCAAAAAATATCGTTGCATAACGAGAGTATC
CTGCTGCTGGATAAAAATTTGGCAGACGATTTTGCGTTTTGTTCACTGGATACGCGACGGCTGGATATCGAAGAGCTGACAGTTTGCCAT
TACTTACAAAATATTCGTCAGTTGCCACGCAATTTAGGATTGCATAGCAAAGACCGTTTGTTAATTAACCAGTCACCCCCCATACAGCTG
GTGACGGCGATTTTTGATAGTTTCAATGACCCCCGGGTCAATTCGCCGATACTGAGCAAAATGCTCTATCTTTCCTGTTTATCAATGTTT
TCTCATAAGAAAGAACTGATCCCCTTACTTTTCAATAGTATCAGTACTGTTTCAGGAAAAGTTGAACGCCTTATTAGCTTTGATATCGCT
AAACGTTGGTATCTACGCGATATCGCAGAAAGAATGTACACCAGCGAGAGTCTCATCAAAAAAAAGTTGCAGGATGAAAATACCTGTTTC
AGTAAAATATTACTCGCCTCCAGGATGTCGATGGCCAGACGATTACTCGAGTTACGTCAAATACCTCTGCATACTATTGCGGAAAAATGT
GGCTATAGCAGTACGTCATACTTTATAAATACATTTAGACAATATTATGGTGTAACGCCACATCAGTTTTCGCAACATTCGCCGGGTACC
TTTTCCTGA

Curator Acknowledgements
Curator Description Most Recent Edit