Burkholderia pseudomallei Omp38

Accession ARO:3004123
CARD Short NameBpse_Omp38
DefinitionHeterologous expression of Burkholderia pseudomallei Omp38 (BpsOmp38) in Omp-deficient E. coli host cells lowers their permeability and in consequence, their antimicrobial susceptibility to penicillin G, cefoxitin, ceftazidime and imipenem.
AMR Gene FamilyGeneral Bacterial Porin with reduced permeability to beta-lactams
Drug Classpenam, cephamycin, carbapenem, cephalosporin, penem, monobactam
Resistance Mechanismreduced permeability to antibiotic
Resistomes with Perfect MatchesBurkholderia malleig+wgs, Burkholderia pseudomalleig+wgs
Resistomes with Sequence VariantsBurkholderia latawgs, Burkholderia malleig+wgs, Burkholderia oklahomensisg+wgs, Burkholderia pseudomalleig+wgs, Burkholderia thailandensisg+wgs
Classification15 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic cefoxitin [Antibiotic]
+ confers_resistance_to_antibiotic ceftazidime [Antibiotic]
+ confers_resistance_to_antibiotic imipenem [Antibiotic]
+ confers_resistance_to_antibiotic benzylpenicillin [Antibiotic]
+ General Bacterial Porin with reduced permeability to beta-lactams [AMR Gene Family]
Publications

Aunkham A, et al. 2014. PLoS ONE 9(5):e95918 Porin involvement in cephalosporin and carbapenem resistance of Burkholderia pseudomallei. (PMID 24788109)

Siritapetawee J, et al. 2004. Biochem. J. 377(Pt 3):579-87 Functional reconstitution, gene isolation and topology modelling of porins from Burkholderia pseudomallei and Burkholderia thailandensis. (PMID 14567756)

Resistomes

Prevalence of Burkholderia pseudomallei Omp38 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Burkholderia lata0%0%6.67%0%
Burkholderia mallei50%0%61.33%0%
Burkholderia oklahomensis50%0%100%0%
Burkholderia pseudomallei49.47%0%89.85%0%
Burkholderia thailandensis50%0%96.97%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 600

Type of Antibiotic Resistance: Acquired


>gb|AAP82271.1|+|Burkholderia pseudomallei Omp38 [Burkholderia pseudomallei] Partial
MNKTLIVAAVAASFATVAHAQSSVTLYGVLDAGITYQSNVATPSGSGKSLWSVGAGVDQSRFGLRGSEDLGGGLKAIFTLESGFNIGNGR
FNNGGGMFNRQAFVGLSSNYGTVTLGRQYDATQDYLSPLSATGTWGGTYFAHPLNNDRLNTNGDVAVNNTVKFTSANYAGLQFGGTYSFS
NNSQFANNRAYSAGASYQFQGLKVGAAYSQANNAGANTTGATDPLTGFNIGGTNAASIQGRSRVYGAGASYAYGPLQGGLLWTQSRLDNL
ANGAPTIRADNYEANVKYNLTPALGLGVAYTYTNAKANGESTHWNQVGVQADYALSKRTDVYAQAVYQRSSKNANASIYNGDLSTPFSTS
INQTAATVGLRHRF


>gb|AY312416.1|+|1-1122|Burkholderia pseudomallei Omp38 [Burkholderia pseudomallei] Partial
ATGAACAAGACTCTGATTGTTGCAGCAGTTGCTGCATCGTTCGCAACCGTCGCTCACGCGCAAAGCAGCGTCACGCTGTACGGTGTGCTC
GACGCGGGCATCACGTACCAAAGCAACGTCGCGACGCCGTCGGGCTCGGGCAAGTCGCTGTGGTCGGTCGGCGCCGGCGTCGACCAAAGC
CGTTTCGGTCTGCGCGGCTCGGAAGACCTGGGTGGCGGCCTGAAGGCGATCTTCACGTTGGAAAGCGGCTTCAACATCGGTAACGGCCGC
TTCAACAACGGTGGCGGCATGTTCAACCGTCAAGCGTTCGTCGGTCTGTCGAGCAACTACGGCACCGTCACGCTGGGCCGTCAGTACGAC
GCAACCCAAGACTACCTGTCGCCGCTGTCGGCAACGGGCACCTGGGGCGGCACGTACTTCGCGCACCCGCTCAACAACGACCGCCTGAAC
ACGAACGGCGACGTCGCGGTGAACAATACGGTCAAGTTCACGAGCGCGAACTACGCCGGCCTGCAATTCGGCGGCACGTACTCGTTCTCG
AACAACTCGCAATTCGCGAACAACCGTGCATACAGCGCGGGCGCTTCGTACCAGTTCCAAGGCCTGAAGGTCGGTGCGGCGTACTCGCAA
GCTAACAACGCTGGCGCGAATACCACGGGCGCAACGGATCCGCTGACCGGCTTCAACATCGGCGGCACGAACGCAGCAAGCATCCAAGGC
CGTTCGCGCGTGTACGGCGCCGGCGCAAGCTACGCTTACGGCCCGCTGCAAGGCGGCCTGCTCTGGACGCAATCGCGTCTCGACAACCTG
GCAAACGGCGCGCCGACCATCCGTGCCGACAACTACGAAGCAAACGTGAAGTACAACCTGACGCCGGCTCTGGGTCTGGGTGTTGCTTAC
ACGTACACGAACGCGAAGGCGAACGGCGAAAGCACTCACTGGAACCAAGTTGGCGTCCAGGCCGACTACGCGCTGTCGAAGCGCACCGAC
GTGTACGCACAAGCCGTGTACCAGCGTTCGTCGAAGAACGCGAATGCGTCGATCTACAACGGCGACCTCAGCACGCCGTTCAGCACGTCG
ATCAACCAAACCGCAGCGACGGTTGGTCTGCGTCACCGCTTC