Erm(51)

Accession ARO:3007033
CARD Short NameErm(51)
DefinitionErm(51) is an Erm ribosomal RNA methyltransferase.
AMR Gene FamilyErm 23S ribosomal RNA methyltransferase
Drug Classstreptogramin antibiotic, macrolide antibiotic, lincosamide antibiotic, streptogramin B antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Sequence VariantsRhodococcus pyridinivoransg
Classification13 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clindamycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ Erm 23S ribosomal RNA methyltransferase [AMR Gene Family]
+ confers_resistance_to_antibiotic pristinamycin IB [Antibiotic]
Publications

Huber L, et al. 2020. Environ Microbiol 22(7):2858-2869 The novel and transferable erm(51) gene confers macrolides, lincosamides and streptogramins B (MLSB ) resistance to clonal Rhodococcus equi in the environment. (PMID 32291839)

Resistomes

Prevalence of Erm(51) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Rhodococcus pyridinivorans10%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 400


>gb|QKE44141.1|+|Erm(51) [Rhodococcus hoagii]
MPTYRPNKGRHENGQNYLVNKSMIKKVVDLVPVSASVPVIEIGPGHGALTFPLQDRVLATGGSLTAVEIDPASVRWLEERLRPEVHLYEQ
DVLDFVLPDGPHVLVGNLPFHLTTAILRHVLHSPGWTHAVFLVQWEVARRRAGVGGATMMTAQWWPWFDFEQHGRIPSTHFRPRPTVDAG
VLVMRRREEPLVNWSERARYASFVHAVFTGKGRGIADIVSRVVGRRRERRCAEVLREAGVPANALPKQLDAGQWATLFKAVGR


>gb|MN928789.1|+|1-792|Erm(51) [Rhodococcus hoagii]
ATGCCTACCTACAGGCCGAACAAGGGCCGTCACGAGAACGGCCAGAACTACCTCGTCAACAAGTCAATGATTAAGAAGGTCGTTGACCTT
GTCCCTGTCAGTGCGTCCGTCCCGGTCATAGAGATCGGCCCGGGACACGGGGCGCTGACCTTTCCCCTCCAGGACCGTGTCCTGGCTACC
GGTGGATCGTTGACCGCCGTCGAGATCGACCCGGCCTCCGTCCGGTGGCTGGAGGAGCGGCTGCGCCCGGAGGTTCACCTGTACGAGCAG
GACGTCCTTGATTTTGTGCTGCCGGACGGCCCGCACGTCCTGGTGGGGAACCTGCCGTTTCACCTGACCACCGCGATCCTGCGGCACGTC
CTTCACTCACCGGGGTGGACTCACGCGGTCTTCCTGGTGCAGTGGGAGGTCGCGCGTCGCCGCGCCGGCGTCGGTGGTGCCACGATGATG
ACAGCCCAGTGGTGGCCCTGGTTCGACTTCGAACAGCACGGGCGAATACCATCCACACATTTCCGTCCCCGCCCCACCGTCGACGCCGGT
GTCCTGGTGATGCGTCGCCGGGAAGAGCCTCTCGTCAACTGGTCGGAGCGTGCGCGGTACGCGTCGTTCGTCCATGCCGTGTTCACCGGC
AAGGGCCGAGGCATCGCCGACATCGTGTCCCGGGTCGTGGGGCGTCGGCGTGAACGACGGTGTGCTGAGGTCCTGCGTGAGGCCGGTGTT
CCGGCAAACGCACTGCCGAAACAGTTGGACGCGGGGCAGTGGGCCACACTGTTTAAGGCCGTGGGGCGCTAA